KEGG   Phaeoacremonium minimum: UCRPA7_3084Help
Entry
UCRPA7_3084       CDS       T03102                                 

Definition
(RefSeq) putative methionyl-trna synthetase protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00450  Selenocompound metabolism
tmn00970  Aminoacyl-tRNA biosynthesis
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    UCRPA7_3084
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    UCRPA7_3084
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tmn01007]
    UCRPA7_3084
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tmn03016]
    UCRPA7_3084
Enzymes [BR:tmn01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     UCRPA7_3084
Amino acid related enzymes [BR:tmn01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   UCRPA7_3084
Transfer RNA biogenesis [BR:tmn03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    UCRPA7_3084
 Prokaryotic type
   Other AARSs
    UCRPA7_3084
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 Anticodon_1 K_channel_TID
Motif
Other DBs
NCBI-GeneID: 19323399
NCBI-ProteinID: XP_007913851
UniProt: R8BQH6
Position
Unknown
AA seq 687 aa AA seqDB search
MGSTTPILPVPGKRNTLITSALPYVNNVPHLGNIIGSVLSADVYSRFSKSRGHPTLFICG
SDEYGTATETKALEEGVSPAELCAKYHALHKGIYDWFEIAFDKFGRTPTPQQTEITQDIF
RKLWKNGYIEERETTQPFCPVEAHHTFLADRFVEGTCSICGDNGARGDQCDKCGNLLDPF
EPEPEAGAPGDDQDVQAKATGWLINPRCKLDGATPERRKTKHLYLRLDALKDEIKSWSDK
ASVDGSWSANCIQIVNSWIQKGLKARGITRDLRWGTPIPTGLDGLSDEEYAKKVFYVWFD
ACIGYVSITKCYTDGDDLQGKNWEKWWKNPDEVSLVQFMGKDNVQFHAIIFPGSQLGTGD
KWTMVHKLSTTEYLNYEDSKFSKSKGVGVFGNNAQDTGIEPNVWRYYLLSRRPETSDSEF
KWQEFVDANNNDLLKNLGNFNQRVLKFCQAKYDSVVPDYTKYTSAEFESHKKQVNATLKE
YIANLEATKLRQGLADVLSISALGNKLLQDNKLDNRLLTEEPDRCAAVIGTALNQIKLLA
SILYPYMPGTAESIFTQLGLEPSPFIPDTWTADDLKPGHKLGAPKLLFTQIPASKVEEWR
EAYGGEEVRKQKALAAEKAAEKKAQKEREKEKKRLKKEAAAAAAAAAAANGQPSSSGTVE
TAEKQQETDPVIEKVTEALEKADVHTS
NT seq 2064 nt NT seq  +upstreamnt  +downstreamnt
atggggtccacgacacccatcttgcccgtcccaggcaagaggaacacgctcattacgagc
gcgttgccttacgtgaacaacgtgccgcatcttggcaacatcattggtagtgtcctctct
gccgatgtctattcacgtttttcaaagagcagaggccatcctaccttgttcatctgcggc
tcggatgagtacggaactgcaactgagaccaaggcgctcgaggagggtgtctcaccggcc
gagctctgcgcaaagtaccatgccctccataaagggatctatgattggtttgagattgcc
tttgacaaatttggtcgcactcccacacctcaacaaaccgagatcactcaagatatattc
cgcaagctctggaagaacggttatatcgaagagcgagagacaactcagcccttctgccca
gtagaggctcatcatacgttcctcgcggatcgctttgttgagggtacatgctctatctgc
ggtgacaacggcgcccgtggtgatcagtgcgataaatgtggtaatttgctagatcctttc
gagccggagccagaagcaggcgctccaggcgatgatcaggacgtccaagccaaagcaacg
ggttggcttattaacccgcgctgtaagctagatggcgcgactcctgaacggcgaaagaca
aagcacctgtatctgcgactcgatgcgcttaaggacgagatcaagtcgtggtcagacaag
gccagtgtagacggcagctggagcgccaattgcattcaaatcgtgaactcatggatccag
aaaggcttgaaggctcgtggaatcacccgtgatcttcgatggggtacccctattcccact
ggtctcgatggcctaagcgatgaagagtatgcgaagaaagtgttctacgtttggtttgat
gcgtgtattggatatgtctccatcacaaagtgctataccgatggagacgacctccaaggc
aagaactgggagaagtggtggaaaaatcctgatgaggtctctcttgttcagttcatgggc
aaggacaacgttcagttccacgccattattttccctggctcacagttgggaactggcgac
aaatggaccatggtccacaaattgtccacaacagagtacttgaactacgaggacagcaaa
ttcagcaagtccaaaggagttggtgtgttcggaaacaacgcccaagatactggcatcgag
ccaaatgtctggagatactatctactttcccgacggccagaaactagcgattccgagttc
aagtggcaagagttcgttgatgctaataacaacgatctcttgaagaacctgggcaatttc
aaccagagagttctcaagttttgccaagccaagtacgatagcgtggtaccggactatacg
aagtacacttcagcggaatttgagagtcataagaagcaggtcaatgctacactaaaagag
tacattgcgaacctagaggcgaccaagttacgacaaggcttggctgacgtcctgtccatc
tctgccctcggaaacaagcttctacaagataacaagcttgacaaccgccttttgaccgaa
gaacctgatcgatgcgccgctgtcattggcactgcactgaaccagattaagctgctcgct
agcatcctctacccctacatgccaggcactgcggagtctattttcacacagctggggctt
gagccttcacctttcatcccagatacctggacagctgatgacttgaagcccggccacaag
ctaggtgcacccaagctcctgttcacgcagatcccggcaagcaaggtcgaagaatggcgc
gaggcatacggtggtgaagaagtcagaaaacagaaggcgctcgccgctgagaaggccgca
gaaaagaaggcacagaaggaaagagagaaggagaagaagaggctcaagaaggaggctgca
gctgcggctgcggctgctgctgcggcgaacggtcagccttcttcgtcgggcaccgtagag
acggcggagaagcagcaagaaactgatcccgtcattgaaaaagtcaccgaggcgctggag
aaggcagacgtgcatacatcctag

DBGET integrated database retrieval system