KEGG   Phaeoacremonium minimum: UCRPA7_4172Help
Entry
UCRPA7_4172       CDS       T03102                                 

Definition
(RefSeq) putative glycoside hydrolase family 32 protein
Organism
tmn  Phaeoacremonium minimum
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 19324596
NCBI-ProteinID: XP_007914911
UniProt: R8BLV8
Position
Unknown
AA seq 563 aa AA seqDB search
MNDPNGLFKDSEGTWHMYYQYGEAVDGNGIYKDWGHTTSTDFYDWVDQPVAIPASDSQGS
IWSGSAIIDTENVSGFFSNQTAAEDNVVAFFTSYTDPQEAQSLAYSLDGGESFIPDPDNP
IISLNRHGFRDPKVTWHEASKKWIMVTTLGDAVAFWTSSDLRDWNQTSVWTPSDPVGIVE
CPQFLTIPRRDDSGKFIESVYVLLISIGNVLYENVRSAVRYMPGTFDGETFTPTPAPDAV
QNGTNYWLQDYDFGPDTYATAFWYDKDAHAQDSVHSISWATQAIGGYACCTPTDTEGWRH
TMTTAREHWLDADYRLVTRPASTGPVAGEPIIDKSDVESVEFAYDDDLQAQNPAVEFTWT
VRARADTTAQLALVSTETGENLTVTVALSAGAASVSLHRSMQGWSSASHIDDWSEASVEP
ASVKGDEATYSIYGIYDRSIFEIFVNDGDSSGTMLFFANGVVDQILVGSADSINSTGTSG
GASASFDFKATTLRSVWGSSTSSKSAVEETRDEGVIRKQGSDDYVALGIQRRESSTSSKS
SAETYVDESVIRKQGSASFRPLG
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaccccaatgggctcttcaaggattctgagggcacatggcacatgtattaccaa
tatggagaggcagtggatgggaacgggatctacaaagattggggacatacaacatccacc
gacttttacgactgggttgatcagcccgtggccattccggcgtcggattctcaggggtcc
atctggtctggcagcgccatcattgacaccgagaacgtgtcgggctttttctccaaccag
acagcggccgaagacaatgtggtggctttcttcacctcctacacggatccccaggaagcg
caatctcttgcctactcgctcgacggcggcgagtcgttcatcccggacccggacaacccg
atcatctccctgaacaggcacggcttccgcgatcccaaggtgacatggcacgaagcttcg
aagaaatggatcatggtaactacgctgggcgatgccgtcgctttctggacttcgtctgac
ctccgtgactggaatcagacttccgtctggactcccagcgaccccgtagggattgttgag
tgcccacaattcctcaccatcccgcgccgcgacgacagcggcaagttcatcgagtctgtc
tatgtgctcctcatctccatcggaaacgtgctctatgagaatgtcagatccgccgtgcgc
tacatgccagggacttttgacggcgagacgttcacgccgacaccagctccggacgccgtg
cagaacggcaccaactactggctgcaggactacgacttcggcccggacacctacgccacc
gccttctggtacgacaaggacgcgcacgcccaggacagcgtccactccatcagctgggcc
acccaggccatcggcggctacgcctgctgcacgccgacggacaccgagggctggcggcac
accatgaccacggcgcgcgagcactggctcgacgccgactacaggctcgtcaccaggcca
gcctcgacgggcccggtggccggcgagcccatcatcgacaagtcagacgtcgagagcgtc
gagttcgcctacgacgacgacctgcaggcccagaaccccgccgtggagttcacctggacg
gtccgggcgcgggcggacaccaccgcgcagctcgcgctcgtgagcacggagacgggcgag
aacctgaccgtgacggtggccctgtcggccggggcggcgtcggtctcgctgcaccggtcg
atgcaggggtggagcagcgcctcgcacatcgacgactggtccgaggccagcgtagagccc
gcctcggtgaagggcgacgaggccacgtacagcatctatgggatctacgaccgctccatc
ttcgagatcttcgtcaacgacggtgactcgagcggcacgatgctcttcttcgccaacggt
gtcgtcgatcagatcctcgttggctcagcggatagcattaatagcactggcaccagcggt
ggcgcgtcagcatcgtttgacttcaaggccacgacgctgaggagcgtctggggctcgtca
acgtcttccaagtccgcggtagaagagactagggacgagggcgtcatcaggaaacagggg
tctgatgattacgttgctctcggcatccagcgtcgcgagtcgtcgacatcgtccaagtct
tcggctgagacatatgtagatgaaagcgtcatcaggaagcaaggcagtgctagtttcagg
ccattaggatag

DBGET integrated database retrieval system