KEGG   Phaeoacremonium minimum: UCRPA7_4261Help
Entry
UCRPA7_4261       CDS       T03102                                 

Definition
(RefSeq) putative exoglucanase 3 precursor protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00500  Starch and sucrose metabolism
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCRPA7_4261
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     UCRPA7_4261
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 19324694
NCBI-ProteinID: XP_007915068
UniProt: R8BLT0
Position
Unknown
AA seq 378 aa AA seqDB search
MKALALLTFVAATSVAAAPSWGRPWKRSSNTSASPFDGKKLFANPAWSQKLDQTYDAFVA
KGDTQNAQKVRSIQDIGTFVWVSDRAGLKNIDDAVAAAREEKKASGVDQIVGLVLYNLPD
RDCSAGESAGELNSSENGLEIYKTEYIKPYAEKVAAATDLTFAIVLEPDSLANLVTNMAV
EKCAAAAPVYEEGIAYAIAQLQFDHVHLYIDAAHGGWLGWDDNLAPSAKLFGKVVRMAGN
STKIRGFSTNVSNYNPFNANPRENFTEYSNSWDESHYASSLAPHLEEEGLPTRFIIDQGR
VALAGSRKEWGEWCNVSPAGFGIKPGTPVNNTLIDSIVWIKPGGESDGQCGMEGAPRAGA
WFDEYVQMLVDNAHSSIA
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcgcttgcattgttaacatttgttgctgctacctcagtggctgcagcgccttct
tggggtcgaccttggaaacgatcaagcaacacatcagccagtccgttcgacggtaagaag
ctatttgccaatccagcttggtcgcagaaactggatcaaacatatgatgcatttgtggcc
aagggcgacactcagaatgcgcaaaaggtccgatcgatccaggacatcggaacattcgtc
tgggtctcggatcgtgctggcttgaagaatatcgacgacgccgttgctgcagctcgagaa
gagaagaaagccagcggtgttgatcagatcgtcggtcttgtgctctataatcttcctgat
agggactgcagcgctggagaaagtgcaggcgagctcaatagttcggagaatgggctcgag
atctataagacggaatacatcaaaccatatgctgaaaaggttgccgctgcgacggatctc
accttcgcaattgtcttggagccggattcactggcaaaccttgtcaccaatatggcagtc
gagaagtgtgctgcagcagctcctgtgtacgaagaaggcattgcctatgctattgcgcaa
cttcaattcgaccacgttcatctatacattgacgccgctcatggcggatggctaggttgg
gatgacaatttggccccgagcgcaaaactattcggaaaggttgtgcggatggctggcaac
agcaccaagattcgcggattttctaccaatgtctccaactacaacccattcaacgcgaac
ccaagagagaacttcacagagtatagcaattcatgggatgaatcccattatgcatcctct
cttgcgccacacctggaggaggaagggctgcctacacgattcattattgatcaggggcgc
gtcgccttggcgggatctcgcaaagaatggggcgagtggtgcaatgtgtctcctgctggc
tttggcatcaaacctggcactccggtcaataacacactcatcgacagcattgtgtggatc
aagcctggtggcgaaagcgacgggcaatgcgggatggagggtgctcctagagctggtgcg
tggtttgatgagtatgttcagatgttggttgacaatgctcattcttctattgcatga

DBGET integrated database retrieval system