KEGG   Phaeoacremonium minimum: UCRPA7_5070Help
Entry
UCRPA7_5070       CDS       T03102                                 

Definition
(RefSeq) putative siroheme synthase protein
  KO
K02304  precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:1.3.1.76 4.99.1.4]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00860  Porphyrin and chlorophyll metabolism
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    UCRPA7_5070
Enzymes [BR:tmn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     UCRPA7_5070
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     UCRPA7_5070
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sirohm_synth_C NAD_binding_7 Sirohm_synth_M ThiF DUF3783
Motif
Other DBs
NCBI-GeneID: 19325586
NCBI-ProteinID: XP_007915809
UniProt: R8BJ91
Position
Unknown
AA seq 232 aa AA seqDB search
MSFPSSQVAAGRILNCLNADASVTVVCPASGLNPEVAFRVAEKQVSHTDRTFEPQDLDGA
DMVLVAVDDPEASTAIWKLCKERRIPANIADVPPECDFYFGSVHRDGPLQIMVSTNGKGP
RLASTIRKYIAGKLPANAGLAIERTGQLRAKLRKIAPQVGDGPKRMSWMIKVSDAFAWDE
MCDMSEEDMDNLLSFYAKDDVPSLDILKSMRGDPQLTKVDVFDGSYGFSVGA
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttccctcatcacaggtcgccgccggccgcattctcaactgcctcaacgccgat
gcctccgtcactgtcgtctgccctgcttccggcctcaaccccgaagtcgcctttcgcgtc
gctgagaaacaggtctcccacactgatcgcaccttcgagccccaggacctcgacggcgcc
gacatggttctggtggctgtcgacgaccccgaggcgtctactgccatatggaagctgtgc
aaggagcggaggataccggccaacattgccgacgtccctcccgagtgcgacttctacttc
ggcagcgtccatcgagacggccccttgcagatcatggtcagcacaaacggtaagggtccg
aggctggcgagcaccatccgtaaatacatagcagggaagctacccgccaacgcggggctg
gccatagaaagaacaggccagttgagggccaaattaagaaagattgcccctcaagttggg
gacgggcccaagaggatgtcatggatgatcaaggtcagcgatgcttttgcctgggacgag
atgtgcgacatgagcgaggaggacatggacaatctcctgagcttctacgcaaaggacgat
gtgccgtctctggatattctcaagtctatgcgtggagatccacagttgaccaaagtcgat
gtctttgacggctcctacggcttttctgttggtgcttag

DBGET integrated database retrieval system