KEGG   Phaeoacremonium minimum: UCRPA7_6149Help
Entry
UCRPA7_6149       CDS       T03102                                 

Definition
(RefSeq) putative heat shock protein ssb1 protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn03040  Spliceosome
tmn04141  Protein processing in endoplasmic reticulum
tmn04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    UCRPA7_6149
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    UCRPA7_6149
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    UCRPA7_6149
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tmn01009]
    UCRPA7_6149
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tmn03041]
    UCRPA7_6149
   03009 Ribosome biogenesis [BR:tmn03009]
    UCRPA7_6149
   03110 Chaperones and folding catalysts [BR:tmn03110]
    UCRPA7_6149
   04131 Membrane trafficking [BR:tmn04131]
    UCRPA7_6149
   03051 Proteasome [BR:tmn03051]
    UCRPA7_6149
   03029 Mitochondrial biogenesis [BR:tmn03029]
    UCRPA7_6149
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmn04147]
    UCRPA7_6149
Protein phosphatases and associated proteins [BR:tmn01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     UCRPA7_6149
Spliceosome [BR:tmn03041]
 Complex B
  Other components
   Prp19 complex
    UCRPA7_6149
 Complex C
   Prp19-CDC5 complex
    UCRPA7_6149
Ribosome biogenesis [BR:tmn03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    UCRPA7_6149
Chaperones and folding catalysts [BR:tmn03110]
 Heat shock proteins
  HSP70 / DNAK
   UCRPA7_6149
Membrane trafficking [BR:tmn04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    UCRPA7_6149
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    UCRPA7_6149
Proteasome [BR:tmn03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    UCRPA7_6149
Mitochondrial biogenesis [BR:tmn03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    UCRPA7_6149
Exosome [BR:tmn04147]
 Exosomal proteins
  Proteins found in most exosomes
   UCRPA7_6149
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 19326775
NCBI-ProteinID: XP_007916880
UniProt: R8BG99
Position
Unknown
AA seq 614 aa AA seqDB search
MAEEVYDGAIGIDLGTTYSCVATYEGNNVEIIANEQGSFTTPSFVSFTEEERLIGEAAKN
QAAMNPVNTVFDVKRLIGRRFDDPTVKKDMESWPFKVVDEDGNPKVQVEYLGGTHTFSPQ
EISAMVLTKMKEIAETKLGKKVEKAVITVPAYFNDNQRQATKDAGAIAGLNVLRIINEPT
AAAIAYGLGSGKSNKERNVLIYDLGGGTFDVSLLNIQGGVFTVKATAGDTHLGGQDFDTN
LLDYCKKEFTRKTKKDLSGDARALRRLRTACERAKRTLSSGAQAQIEIDSLFDGEDFNIS
VTRARFEDLNQKAFAGTINPVEQVLKDASIEKSAVDEIVLVGGSTRIPKIQKLLSDFFDG
KKLEKSINPDEAVAYGAAVQAGILSGKATSADTSDLLLLDVVPLSLGVAMEGNIFAPVVA
RGQTVPTLKKRTFTTVADNQQTVQFPVYQGERVNCEDNTSLGEFTLAPIPPMKAGEPVLE
VVFEVDVNGILKVTATEKTSGRSANITISNSVGKLSSSEIENMISDAEKFKTNDEAFSKR
FEAKQQLESYISRVEEIISDPTLSLKLKRGQKEKIEQTLSDAMSQLELEESSADDLKKKE
LALKRLVTKAMSSR
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
atggccgaagaagtgtatgatggtgccatcggcatcgatctgggtaccacctactcctgc
gttgccacatacgagggtaacaatgtcgagatcatcgccaacgagcagggtagcttcact
accccctcgttcgtctccttcacagaggaggagcgattgatcggtgaggctgccaagaac
caggctgccatgaacccggtcaacaccgtcttcgatgtcaagcgactgattggccgtcgt
ttcgacgaccctaccgtcaagaaggacatggagtcatggcccttcaaggttgtcgacgag
gatggcaaccccaaggtccaggttgagtacctcggtggcacgcacaccttctccccccag
gagatctccgccatggtcctcaccaagatgaaggagattgccgagaccaagctcggcaag
aaggtcgagaaggctgtcatcactgtcccggcctacttcaacgacaaccagcgtcaggcc
accaaggacgccggtgctattgccggtctcaacgtcctccgtatcatcaacgagcctacc
gctgctgccattgcctatggtctgggctctggcaagtccaacaaggagcgcaacgttctc
atctacgatcttggtggtggtactttcgatgtctccctgctcaacattcagggtggtgtc
ttcaccgtcaaggctactgctggtgatactcacttgggtggtcaggacttcgatactaac
ctgctggactactgcaagaaggagttcaccaggaagaccaagaaggatctcagcggagat
gcccgtgctctgcgaagactccgaactgcttgcgagcgtgccaagcgtaccctctccagc
ggtgctcaggctcagatcgagattgactccctcttcgatggcgaggacttcaacatctct
gtcactcgtgcccgtttcgaggacctcaaccagaaggccttcgctggcaccatcaacccc
gttgagcaggttcttaaggatgctagcatcgagaagagcgcagttgacgagattgtgctc
gttggtggttccacccgtatccccaagatccagaagcttctgagcgacttcttcgatggc
aagaagctcgagaagagcattaaccccgatgaggctgttgcctacggtgccgccgtccag
gccggtatcctctccggaaaggccacctctgccgacacctctgacctccttctcttggat
gtcgttcctctgtctcttggtgtcgccatggagggcaacatcttcgcccctgtcgttgct
cgtgggcagacagtgccgaccctgaaaaaacgaacctttaccaccgtcgctgataaccag
cagaccgtccagttccccgtttaccagggtgagcgtgtcaactgcgaggacaacacctct
ctgggagagttcactcttgctcccattcctcccatgaaggctggtgagcccgttcttgag
gtcgtcttcgaggtcgacgtcaacggtatcctcaaggtcactgccactgagaagacctct
ggccgcagcgccaacatcaccattagcaattctgttggcaagctctcatccagcgagatt
gagaacatgatcagcgatgccgagaagttcaagaccaacgatgaggccttcagcaagaga
ttcgaggccaagcagcagcttgaatcctacatctcccgtgtcgaggagattatctccgac
ccgactctgtccctcaagcttaagcgcggacagaaggagaagattgagcagactctcagc
gatgccatgtcccagcttgagctcgaggagtccagcgctgatgacttgaagaagaaggag
ctggccctcaagagacttgtaaccaaggccatgtcctcaagataa

DBGET integrated database retrieval system