KEGG   Phaeoacremonium minimum: UCRPA7_7029Help
Entry
UCRPA7_7029       CDS       T03102                                 

Definition
(RefSeq) putative extracellular invertase protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00052  Galactose metabolism
tmn00500  Starch and sucrose metabolism
tmn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    UCRPA7_7029
   00500 Starch and sucrose metabolism
    UCRPA7_7029
Enzymes [BR:tmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     UCRPA7_7029
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32C Glyco_hydro_32N
Motif
Other DBs
NCBI-GeneID: 19327748
NCBI-ProteinID: XP_007917755
UniProt: R8BDV6
Position
Unknown
AA seq 519 aa AA seqDB search
MHYTDAETGLFHVGWLHSGAAGATTDDLVTYHDLNPDGAPFIVAGGVNDPIAVFDGSVIP
SGIGGQPTLLYTSVSYLPIQWTIAYTRGSETQSLAVSSDGGRNFTKLEQGPVIPSPPFAV
NVTGFRDPYVFQNAQLDSLLGSDEGTWYVIISGGVHGDGPSQFLYRQYDTDFQYWEELGQ
WWHEPANSTWGNGDWAGRWGFNFEVGNVFSLDQDGYNTEGEVFTTLGAEWSLDPIVPQVS
DFRDMLWAAGNVSLKDGTAKFTPTMAGRLDWGASAYAAAGKVLPASSLASSKSGAPDRFI
SYVWLTGDFYGTLDPATNQQNWTGALLLPRELSVGKISNVVDNDLSRETGSWRIASNTSG
VLELTTLKQEIAREPLAALLNGTTSTEPGRTVNASGIAAFQKSPDTKFYVLKTSLKFPQS
ARGSDLKAGFQILASEYESTTIYYQFSNESIIIDRSNTSAAALTTNDIDSRNEAGKLRLF
DVVQAGEEEVETLDLTIIVDNAVVEVHANSRFALGTWAR
NT seq 1560 nt NT seq  +upstreamnt  +downstreamnt
atgcattacactgatgcagaaacgggtctcttccacgttggctggctacacagtggtgct
gccggggctacgaccgatgatcttgtgacctaccacgatctcaatcccgacggagcccca
ttcatcgttgccggcggtgtgaacgaccctattgccgtctttgatggctcagtcattcct
agtggtattggggggcaaccaactctgctgtacacctcggtgtcgtatttgcccattcag
tggaccattgcttacactagaggaagtgagacgcaatctctagcggtctcatctgatggt
ggacgtaacttcaccaagcttgaacaaggacccgtcatcccctctccgccgttcgcagtc
aacgtgaccggcttccgcgatccctacgtctttcaaaacgcgcagctggattcgctcctc
ggcagtgatgagggtacctggtatgtgattatatcgggtggtgtgcatggcgatggtccc
agccaattcctatatcgacaatacgacacagacttccaatattgggaagagctcggccag
tggtggcatgaacccgcgaactcaacttggggcaatggtgactgggctggacgatggggc
ttcaattttgaagtcggtaacgtattcagccttgaccaagatggatacaataccgaaggt
gaagtgttcaccactttaggtgctgaatggtcgctcgatcctattgtaccgcaggtctca
gacttccgtgacatgctgtgggcagccggcaacgtttctctgaaggacggcactgccaag
ttcacgcctaccatggctggacgtttggactggggcgcatctgcatatgccgcggctgga
aaagtcctgccagcgtcttcactggcgtcaagtaagagcggtgcgcctgatcggttcatt
tcatacgtatggcttactggcgacttctatggtacccttgaccctgcgacaaatcaacag
aactggacaggtgctctgctactccctcgagaattaagcgtaggcaaaatcagcaatgtt
gtggacaacgacctctcacgggaaactgggtcatggcggatagcaagcaatacctctggt
gtcttggagctcaccactctcaaacaggagattgcgagagagccgctggctgctctgctg
aacggcacgacatccaccgagcctggccgaacagtgaacgcctctggaattgcagcgttt
cagaagtcgcccgataccaagttctatgttctcaagacgtctctcaagtttccacagtca
gctcgtggaagcgatctcaaagcgggcttccagatcttggcttctgagtatgagtcgacg
acaatttactaccaattctccaacgagtctatcattatcgaccggagcaacacaagcgcg
gcggctttaaccacgaatgacattgattcaagaaacgaagctggcaaactgcgattgttc
gacgtcgtccaggctggcgaggaagaagtagaaacacttgatttgactatcatagtcgat
aatgcagtcgtcgaggtgcacgctaacagcaggtttgccttgggcacttgggctaggtga

DBGET integrated database retrieval system