KEGG   Phaeoacremonium minimum: UCRPA7_7791Help
Entry
UCRPA7_7791       CDS       T03102                                 

Definition
(RefSeq) putative pyruvate decarboxylase protein
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
tmn  Phaeoacremonium minimum
Pathway
tmn00010  Glycolysis / Gluconeogenesis
tmn01100  Metabolic pathways
tmn01110  Biosynthesis of secondary metabolites
tmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UCRPA7_7791
Enzymes [BR:tmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     UCRPA7_7791
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M
Motif
Other DBs
NCBI-GeneID: 19328580
NCBI-ProteinID: XP_007918504
UniProt: R8BBM9
Position
Unknown
AA seq 570 aa AA seqDB search
MTVVHNQTKYTVGDYLAERLAQIGLRHHFVVPGDYNLILLDKLSAHPDLTEIGCANELNC
SLAAEGYARAHGASACVVTFSVGALSAFNGTGSAYAENLPLILISGSPNTNDAGEFHLLH
HTLGSSDYTYQYEMAKKITCCAVAVNRAQEAPRLIDRAIRHALLARKPCYIEIPTNLSGA
ECVRPGPISAVTEPVSSDKSALQAAADCAAEYLKGKLKPVILVGPKVKRCASEKELIALA
DAMGCAVAVQPAAKGMFPEDHKQFVGVFWGQVSTDAADAIVHWADAIICVGTVFTDYSTV
GWTALPNIPLMVAEMDHVTFPGAHFSRVRLPEFLAHLASEVDFNDSTMIEYNRLRPDPVQ
VHAAAKEDLLTRKEISRQMQNMLNAQSTLFVETGDSWFNGIQLKLPPGARFEIEMQWGHI
GWSIPAAFGYALRHPDRRTIVVVGDGSFQVTAQEVSQMVRYKVPITIILVNNRGYTIEVE
IHDGSYNKIKNWNYALLVQAFNSTDGKATSFVANTAGELADAIQESAENTEGPTLIECTI
DQDDCSKELITWGHYVAAANARPPRHRLDD
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtggttcacaaccaaacaaagtataccgtgggcgactacctggccgagcggtta
gcccagatcggtctgcgccaccacttcgtcgtgccaggcgactacaacctcatcttgctt
gacaagctctccgcacacccggatctcacagagatcggctgcgcaaatgagctcaactgc
tcgctggccgctgaaggctacgcccgcgcacacggcgcgtccgcctgcgtcgtcaccttc
tccgtcggcgctctttctgcgttcaacggcacgggcagcgcctatgccgagaacctgccc
ctgattctgatttcggggtcaccaaacacaaatgatgccggcgaattccatctcctgcat
cacaccctgggctcatctgattatacgtaccagtatgagatggccaagaagatcacatgc
tgcgccgttgccgtcaaccgcgcccaagaagcccccaggctgattgaccgtgccatccgt
cacgccctgctcgccaggaaaccctgctacattgagatccccacgaacctgtccggcgcg
gagtgcgtgcgacccggccccatctcggccgtcactgagccggtcagctccgataagtcg
gcgctgcaagccgcggcagactgtgcggccgagtacctaaagggcaagttaaagcccgtc
atcctggttggcccaaaggtcaagcgctgtgcctccgagaaggagctgatcgcactcgcc
gacgccatgggttgtgcggtagccgtgcagcccgctgccaagggtatgttccccgaggat
cacaagcagtttgtcggcgtcttctggggccaagtgtccacagacgccgcagacgcgatt
gtccactgggccgacgccattatttgtgtcggaaccgtctttaccgattacagcaccgtc
ggctggaccgcgctgcccaacatcccgctcatggttgctgagatggaccatgtgacgttc
cccggtgcgcacttcagccgtgtcaggctccccgagttcctggctcatctggcgagcgag
gtggacttcaacgactccaccatgatcgagtacaaccggctccgacccgacccggtccag
gtacacgcggcggccaaggaggatcttctgacgagaaaagagatttcccgccagatgcag
aatatgctgaatgcccagtcgacactgttcgtcgagaccggcgattcgtggttcaacggc
atccagctcaagctgccgcccggcgcccgcttcgagattgagatgcagtggggtcacatt
ggctggtccatcccggcggcgttcggctacgcgcttcggcatccggatcggcgcacgatc
gtcgtggtcggcgacgggtccttccaggtgaccgcgcaggaggtcagccagatggtgcgg
tacaaggtgcccatcaccatcatcctggtcaacaaccgcggctacacgatcgaggttgag
atccacgacggatcctacaacaagatcaagaactggaactacgccctattggtccaggcg
ttcaacagcaccgacggcaaggctaccagctttgtcgcgaacacggcaggcgagctggcc
gatgccatccaagagtcggctgagaacaccgagggcccgacactgatcgagtgcaccatc
gaccaggacgattgctccaaggagctcatcacctggggacactatgtcgccgccgccaac
gccagaccgccaaggcataggctggacgactaa

DBGET integrated database retrieval system