KEGG   Tistrella mobilis: TMO_0843Help
Entry
TMO_0843          CDS       T02128                                 

Gene name
ubiX
Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
tmo  Tistrella mobilis
Pathway
tmo00130  Ubiquinone and other terpenoid-quinone biosynthesis
tmo00627  Aminobenzoate degradation
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    TMO_0843 (ubiX)
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    TMO_0843 (ubiX)
Enzymes [BR:tmo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     TMO_0843 (ubiX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein DUF3875
Motif
Other DBs
NCBI-ProteinID: AFK52682
UniProt: I3TIU4
Position
complement(933316..933975)
Genome map
AA seq 219 aa AA seqDB search
MDMTTDGFNPPDDGSMTAMNGMGRPGPRRLIVGISGASGVVYGIRLLQLLKSAGIESHLV
MSKAAEMTVAYETALRIAEVKALAHTVHDPRDVGAAISSGSFRTLGMVVAPCSIRSLSEI
AYGNTTGLLTRAADVVLKERRRLVLMVRETPLHLGHLRAMTQAAEAGAIIAPPVPAFYAK
PDSLQAMIDHTLGRVLDLFDIDTPGLKRWGETPPQGQED
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
gtggatatgacgacggacggcttcaacccccccgatgacggttcgatgacggcaatgaat
ggcatgggccgccccgggccccgccgtctgatcgtcggcatctcgggcgcctcgggcgtc
gtctacggtatccgcctgttgcagttgctgaaatcggccgggatcgagagccatctggtg
atgagcaaggcggccgagatgacggtcgcctatgaaaccgctctgcgcatcgccgaggtg
aaggccctggcccacacggtccatgatccgcgcgatgtgggtgctgcgatctccagcggc
tcgttccgcacgctgggcatggtggtcgccccctgctcgatccgcagcctgtcggaaatc
gcctatggcaacaccaccggcctgctgacccgtgccgccgatgtggtgctgaaggaacgc
cgccggctggtgctgatggtccgcgaaaccccgctgcatctgggccatctgcgcgccatg
acccaggccgcggaagccggcgccatcatcgccccgccggtcccggccttctatgcaaag
cccgacagcctgcaggcgatgatcgaccacaccctcggccgggtgctggacctcttcgac
atcgacacgccggggctgaagcggtggggggagacgccgcctcagggccaggaggattga

DBGET integrated database retrieval system