KEGG   Tistrella mobilis: TMO_1952Help
Entry
TMO_1952          CDS       T02128                                 

Definition
(GenBank) Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) family
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tmo  Tistrella mobilis
Brite
Enzymes [BR:tmo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     TMO_1952
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 Methyltransf_23 MTS Methyltransf_12 Methyltransf_3 Methyltransf_4 Methyltransf_11 CMAS Ubie_methyltran PrmA MetW Methyltransf_32 Methyltransf_18 GCD14 RrnaAD Methyltr_RsmB-F
Motif
Other DBs
NCBI-ProteinID: AFK53790
UniProt: I3TM02
Position
2163558..2164793
Genome map
AA seq 411 aa AA seqDB search
MPQDLRLDALQNGLLHRIESYVPVRGRPAPPRPALIEAFRRHPRHLFLPRYRPADQPEGP
ARAPGDAGFPEGAYHDRPLCYVDEHGISLPASCSEPGFIFHLAELLDVRPGHRVLEIGCG
TGWLLAILAHAAGPDGTVVGVEINPALQALAARNLAAAGATNAIAVAGDGLAAAGPGPFD
RIIMTASAWQLPTRILSLLTEDGLAVLPIRNKGLSEEIHVLERRGPALVSRLTRLCRFVP
LTGRDGADENLLMPRLTADPDIARLGETGRPRSLDFGQPIPDRMMPPALAFTAWMSKLEP
RFRAWRLGPGDGPPSLFGDPERHGFGLVDKSAGSATLWRAGQVIAYGDESTRDALFDHLA
RWTAQDGPTGYAFGLGITAARGTSPVSHHAYRKRRGPLDFWWWLRPPAERL
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccacaggatcttcggcttgacgccctgcagaacgggctgctgcacagaatagagagc
tatgtgccggtgcgcggacggccggcaccgccgcgcccggccctgatcgaggcgttccgg
cgccatcctcgccacctctttctgccgcgctaccgcccggcggatcagcctgaggggccg
gcacgcgccccgggtgatgccggctttccagagggcgcctatcacgaccgcccgctctgt
tacgtcgacgagcacggtatctccctgcctgcctcctgctccgagccgggcttcattttc
catctggccgagttgctggacgtccggcccggtcatcgggtgctggaaatcggctgcggc
accggctggctgctcgcgatcctcgcgcacgccgccgggccggatggaacggtggtgggc
gtggagatcaaccccgctctgcaggctctggccgcccgcaatcttgccgcggcgggagca
accaatgcgatcgccgtcgcaggtgacggcctcgcagccgccggcccgggccccttcgac
cgcatcatcatgaccgcctcggcctggcagctgccgaccaggattctcagcctgctcacg
gaagacgggctcgccgttcttccaattcgtaacaaaggcttgtcagaagagattcacgtt
ttggagcggcgcggtccggcgctggtgtcgcgcctgacacgcctctgccgtttcgtgccg
ctgaccggtcgcgatggcgcggatgaaaatcttctcatgcctcgcctgaccgcagacccc
gacatcgcccggcttggcgaaaccgggcggccacgatcgctcgacttcggccaaccgata
ccggatcgaatgatgccgccggcgctcgcctttaccgcctggatgtcaaagctggagccg
cgcttccgcgcctggcggctcggcccgggtgacgggccgccatccctgttcggtgatccg
gagaggcatggtttcggtctggtggacaagtccgccggatccgccaccctctggcgcgca
ggccaggtgatcgcttatggcgacgagagcacacgcgatgcgctcttcgaccatctggcg
cgatggacggcacaggacgggccgacgggttatgctttcggcctcggcatcactgccgcc
cgagggacgtctccggtctcacaccacgcttatcgcaagcgccggggcccgctcgatttc
tggtggtggctgcgcccgcccgccgaacggctgtag

DBGET integrated database retrieval system