KEGG   Tistrella mobilis: TMO_2578Help
Entry
TMO_2578          CDS       T02128                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmo  Tistrella mobilis
Pathway
tmo00071  Fatty acid degradation
tmo00072  Synthesis and degradation of ketone bodies
tmo00280  Valine, leucine and isoleucine degradation
tmo00310  Lysine degradation
tmo00362  Benzoate degradation
tmo00380  Tryptophan metabolism
tmo00620  Pyruvate metabolism
tmo00630  Glyoxylate and dicarboxylate metabolism
tmo00640  Propanoate metabolism
tmo00650  Butanoate metabolism
tmo00900  Terpenoid backbone biosynthesis
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
tmo01212  Fatty acid metabolism
tmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TMO_2578
   00630 Glyoxylate and dicarboxylate metabolism
    TMO_2578
   00640 Propanoate metabolism
    TMO_2578
   00650 Butanoate metabolism
    TMO_2578
  09103 Lipid metabolism
   00071 Fatty acid degradation
    TMO_2578
   00072 Synthesis and degradation of ketone bodies
    TMO_2578
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    TMO_2578
   00310 Lysine degradation
    TMO_2578
   00380 Tryptophan metabolism
    TMO_2578
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TMO_2578
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    TMO_2578
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    TMO_2578
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmo04147]
    TMO_2578
Enzymes [BR:tmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     TMO_2578
Exosome [BR:tmo04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TMO_2578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AFK54416
UniProt: I3TNS8
Position
complement(2857245..2858438)
Genome map
AA seq 397 aa AA seqDB search
MTTATDPIVIVGAARTPMGGFQGELKDLTASELGASAIRAALTRAGVDAADVEEVVMGCV
LPAGQGQAPARQASLGAGLPLDAGCTTINKMCGSGMKAAMFAHDQLLAGSNTVMVAGGME
SMTNAPYLLDKARGGYRMGHGRVMDHMFLDGLEDAYDKGRLMGTFAEDTARHYQFTRESQ
DDFAITSLKRAQKAGEDGSAAVEITPVSVKTRSGTAEIGIDEQPRKANLDKIPTLRPAFA
KDGTVTAANSSSISDGAAALVLMRASEAERRGLTPLARILGHATHAQEPAWFTTAPIGAM
NKLFARTGWSAKDVDLYEINEAFAVVTMAAMKELDLDHERVNIYGGACALGHPIGASGAR
ILVTLLNGLKRNGMTRGVASLCIGGGEATAMAVELMN
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccgccaccgatccgatcgtcatcgtcggcgccgcccgcacgcccatgggcggc
ttccagggcgagcttaaggacctgaccgcttccgaactgggcgcttcggcgatccgcgcg
gccctgacccgcgccggcgtcgatgccgccgatgtcgaggaagtggtgatgggctgcgtg
ctgcccgccggccagggccaggcgcccgcccgtcaggcctcgctcggcgccggcctgccg
ctggatgccggctgcaccaccatcaacaagatgtgcggctcgggcatgaaggccgcgatg
ttcgcccatgaccagctgctggccgggtccaacaccgtgatggtggccggcggcatggag
agcatgaccaacgccccctatctgctcgacaaggcccgcggcggctatcgcatgggccat
ggccgggtgatggatcacatgttcctggacgggctggaggatgcctacgacaagggccgc
ctgatgggcaccttcgccgaggacaccgctcgccattaccagttcacccgcgaatcgcag
gacgacttcgcgatcacctcgctgaagcgcgcccagaaggctggcgaggacggcagcgcc
gccgtcgagatcaccccggtcagcgtcaagacccgcagcggcacggccgagatcggcatc
gacgagcagccgcgcaaggccaatctcgacaagatcccgaccctgcgcccggccttcgcc
aaggacggcacggtgacggccgcgaattcgtcgtcgatttccgacggggccgcggcgctg
gtgctgatgcgggcctcggaagccgagcgtcgcggcctgaccccgctcgcccggatcctc
ggccatgcgacccatgcccaggagccggcctggttcaccaccgcgccgatcggcgccatg
aacaagctcttcgccaggaccggctggtcggcgaaggatgtcgacctctacgagatcaac
gaggccttcgcggtcgtcaccatggcggcgatgaaggagctggatctcgaccacgagcgg
gtgaacatctatggcggcgcctgcgccctcggccacccgatcggggcctcgggcgcgcgc
atcctggtgaccctgctcaacggcctgaagcgcaacggcatgacccgtggcgtggccagc
ctgtgcatcggcggcggcgaagcgaccgccatggccgtcgagctgatgaactga

DBGET integrated database retrieval system