KEGG   Tistrella mobilis: TMO_a0077
Entry
TMO_a0077         CDS       T02128                                 

Definition
(GenBank) hypothetical protein
  KO
K11891  type VI secretion system protein ImpL
Organism
tmo  Tistrella mobilis
Pathway
tmo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TMO_a0077
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0077
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TMO_a0077
SSDB
Motif
Pfam: IcmF-related_N IcmF-related IcmF_C AAA_33
Other DBs
NCBI-ProteinID: AFK55480
UniProt: I3TRU2
Position
pTM1:complement(78000..81725)
AA seq 1241 aa
MSRVIEVLASKWFLSFLGIALLGVLVWVGGPLVAIGDSRPFEPVLTRALIAGGLFLIWAV
AFVWSVIAARRRNAAMIEAIAAPEGPTPEDEEVDRLRERMVQALETLKRSRLGRGRQWLY
QLPWYLMIGPPGAGKTTALINSGLDFPLAEDQAERRMRGIGGTRDCDWWFTDQAVLIDTA
GRYTTQDSDGGVSSDGTAAGPGTRAGGRDRAGWQGFLELLKKHRPRQPVNGVLVCISLAE
VALASAAERDAHARALRRRLRELTEQLDVRVPVYVLVTKADLLAGFTAFFDDLDAAGRAQ
VWGMTFPFDDEVESEGESKGESGSRSAGAVAHFDAEFDRLIDRLNARVIDRMHAEPDGER
RALIHGFPAQMASVRAPLGDFLRQVFQPTRLAERPLLRGVYLTSGTQEGTPFDRLTGAMA
RSFGLDRATQPPMTGRGRAFFLADLLNRVVFAEAGVVTTDPAAARRRRLIRHAGFATAAV
VAIACVAAWTVSYFGNSRLIDEAAAGIEEYRGAVTPFAETAVADDDLAELSPVLDRLRDV
PTGAAETEAGLETPIDRGFGLDQAPTLSQGTVSAYHRALNRLFLPRLLVRLENQLRAAAS
PSDVSYTALKVYLMLGAQGPIEPEVIGAWMALDWQNRWPGEENAPLRAALQDHLAALLDR
PIASVPLDGALVEQVRTLLASQPLAERVYARLVESPAATALPAWTPVDHAGPQAARVLVR
RSGKRLSEGIPGIYTYDGFHNTFLPALEAEVRATAEEGWVLSEKTRALTDEEVAKLARDT
LQLYYDDYVGIWNGLIADIDLAAFQSDTHAVESLNVLSSPRSPMVTLLKAVADETRLATP
RGDATAGGGDTGQAGNGRPSGSERAGDAVALEAESRMQRQFGFSGRIASLLLRDAASDAL
AGGNGGGGKELPGAYVEERFKELDGFVTAGPGGQAPVDAIVDDLGQLYRAMSRGRMAVDG
PGGGAAAEAELAGLAQQLSLDAGRAPDVMRGWAETIAERASSRTIGDTRARLNEAWALDG
RDLCRTALAGRYPFDRGSRQDVKLDDFARIFAGGGILDGFFRKELAPYVETGGRRWSWRK
INNADLGIPNAVLADFREAARIRDAFFPGGGTVPDIGFDLVPVSLTPSAARVVVEVNGQT
AAYDHGPVRPMPLRWPGNGPQQVRVTFIGTDGTPAGGTSLTGPWALFRLIDRSEVRQIAS
DRFEVTFRAGQNAARFEVRAGSVLNPFSLDDLRSFSCPRRF
NT seq 3726 nt   +upstreamnt  +downstreamnt
atgtcgcgcgtgatcgaggtgctggcctcgaaatggttcctgagcttcctgggcatcgcc
ctgctgggggtgctggtctgggtgggcgggccgctggtcgcgatcggcgacagccggccg
ttcgaaccggtgctgacccgggcgctgatcgcgggcgggctgtttctgatctgggcggtg
gctttcgtgtggagcgtgatcgccgcccgccgccgcaatgccgcgatgatcgaggcgatc
gccgcccccgaaggcccgacgcccgaggatgaggaagtcgaccggctgcgcgagcgcatg
gttcaggcgctggaaacgctgaagcgctcgcggctgggccgtggccggcaatggctgtac
cagctgccctggtatctgatgatcggcccgcccggcgccggcaagaccaccgcgctgatc
aattcggggctggatttccccctggcggaggatcaggccgagcgccggatgcgcggcatc
ggcggtacccgcgactgcgactggtggttcaccgaccaggcggtgctgatcgacaccgcc
ggccgctataccacgcaggacagcgatggcggcgtgtcgtccgatgggacggctgcggga
cccgggacgcgggcaggcgggcgtgaccgtgccggctggcagggctttctggagctgctg
aagaagcaccgcccgcgccagccggtgaacggcgtgctggtctgcatttcgctggccgag
gtggcgctggcctctgccgccgaacgcgatgcccatgcccgcgcactgcgccgccggctg
cgcgagctgaccgaacagctggatgtgcgggtgccggtttatgtgctggtcaccaaggcc
gatcttctggccgggttcaccgcgtttttcgacgatctggacgcggccggccgcgcccag
gtctggggcatgaccttccccttcgacgacgaggtcgagagcgagggggagagcaagggt
gagagcggcagccgaagcgctggggccgtcgcgcatttcgatgccgaattcgaccggctg
atcgaccggctgaacgcccgggtcatcgaccggatgcatgccgagcccgatggtgagcgc
cgggcgctgatccatggcttcccggcgcagatggcctcggtccgggcccccctgggcgac
tttctgcgccaggtgttccagccgacccggctggccgagcggccgctgctgcgcggcgtg
tatctgaccagcggcacccaggagggcacgcccttcgaccggctgaccggcgccatggcc
cggtccttcggtctggatcgtgccacccagccgccgatgaccggccgcggccgcgccttc
ttcctggcggatctgctgaaccgggtggtgttcgccgaagccggcgtggtcacaaccgac
cccgccgccgcccggcgccggcggctgatccgccatgccggttttgcgaccgccgccgtg
gtcgccatcgcctgcgttgccgcctggacggtctcgtacttcggcaacagccggctgatc
gacgaggccgcggccggcatcgaggagtatcgcggggcggtgacgccttttgccgaaacg
gcggtggccgatgacgatctggcggaactttcgcccgttctggaccggttgcgcgacgta
ccgaccggtgcggcggaaaccgaggccgggcttgagaccccgatcgatcgcggcttcggg
ctggaccaggcgccgaccctgtcgcagggcacggtgtcggcctatcaccgggccctgaac
cgcttgttcctgccgcgactgcttgtgcgcctggagaaccagctgcgggcggcggcctcg
ccgtcggatgtgtcttacaccgcgctcaaggtctatctgatgctgggcgcgcaggggccg
atcgagcccgaagtgatcggcgcctggatggcgctggactggcagaaccgctggccgggc
gaagagaatgcgccgctgcgtgcagcacttcaggaccatctggcggcgctgctcgaccgg
ccgatcgcctcggtgccgctggatggtgcgctggtcgaacaggtgcgcacgctgctggcc
tctcaacctttggccgaacgggtctatgcccggctggtcgagagcccggccgcaaccgcc
ctgccggcctggacgccggtcgaccatgccgggccgcaggcggcgcgggtgctggtccgc
cgatcgggcaagcggctgtcggaaggcattcccggcatctatacctatgacggcttccac
aacaccttcctgccggcgctggaagcggaggtgcgcgccaccgccgaagagggctgggtg
ctgagcgagaagacccgcgcactgaccgacgaagaggtggcgaaactcgcccgtgacacc
ctgcagctctattacgacgactatgtcgggatctggaacgggctgatcgccgatatcgat
ctggccgccttccagagcgacacccatgcggtggaaagcctgaacgtgctgtcctcgccg
cgctcgccgatggtgaccctgctgaaggcggtggccgacgaaacccggctggcgaccccg
cgcggggatgccacagccggaggcggcgataccgggcaggcgggcaatggccggccgtcc
ggcagcgagcgtgcgggcgatgcggtggcgcttgaggccgagagccggatgcagcgccag
ttcggcttcagcggccggatcgccagcctgctgctgcgcgatgcggcatcggatgcgctg
gcgggcggcaatggcggcggcggcaaggagctgcccggcgcctatgtcgaagagcggttc
aaggagctggacggcttcgtgaccgccggccccggcggtcaggcgccggtggatgcgatc
gtcgacgatctgggccagctttaccgggcgatgagccgcggccgcatggcggtggacggc
cccggcggcggggctgcggccgaggcggaactggccgggctggcgcagcagctgtcgctg
gatgccgggcgcgcgcccgatgtgatgcgcggctgggccgagaccatcgccgagcgcgcc
tccagccgcaccatcggcgacacgcgggcccggctgaacgaggcctgggcgctggacggc
cgcgatctctgccgcacggcgctcgccggccgctatcccttcgatcgcggcagccgccag
gatgtgaagctggacgattttgcccggatcttcgccggcggcggcattctggacggcttt
ttccgcaaggagctggcgccctatgtggagaccggcggccggcgctggagctggcgcaag
atcaacaatgccgatctgggcattccgaatgccgtgctggccgatttccgcgaggcggcg
cggatccgtgatgccttcttccccggcggcggcaccgtgcccgatatcggcttcgacctg
gtgccggtgtcgctgacgccgtcggccgcccgggtggtggtggaggtgaacggccagacc
gccgcttacgatcacgggccggtgcggccgatgccgctgcgctggccgggcaatggcccg
cagcaggtgcgcgtcaccttcatcggcaccgacggcaccccggcgggcggcaccagcctg
accggcccctgggcgctgttccggctgatcgaccggtcggaggtgcgccagatcgcgagc
gaccgtttcgaggtgaccttcagggccgggcagaatgccgcgcgcttcgaggttcgcgcc
ggatcggtgctcaaccccttctctctcgacgatctgaggtcgttttcatgtccgcggcgc
ttctga

DBGET integrated database retrieval system