KEGG   Tistrella mobilis: TMO_a0081Help
Entry
TMO_a0081         CDS       T02128                                 

Definition
(GenBank) FHA domain-containing protein
  KO
K11913  type VI secretion system protein
Organism
tmo  Tistrella mobilis
Pathway
tmo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TMO_a0081
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0081
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   TMO_a0081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FHA Yop-YscD_cpl
Motif
Other DBs
NCBI-ProteinID: AFK55484
UniProt: I3TRU6
Position
pTM1:complement(85211..86617)
Genome map
AA seq 468 aa AA seqDB search
MRLVIDIAHRDDPATRIGPSRSFDRRGLRVGRGPANDVVLEDPTRVISGQHCLIDYDSGR
FRLIDTSTNGSFVNDPRRPVPRETGHVVADGDRVFVGDYVLTLGLMPVPDEAPAPRPARP
LHAAPKPVQRPDPGAAFSGGEPPATAFAFTPPRVARVEIPEDWDADGQNLDGLMAAPEND
PSDPPAPPIRRPPQPPSQPPRPPRDPDPIPVEDPEDVPLEDPVPIRDPEPLPDPDPDEDP
EPYRDPPPRQTPPPSEYRLRDDRLYDAFLSGAGLTREQLPPSRAEEVLRTAGEVFRATAR
GLIETLSARAELKGEFRIERTTIKPRNNNPLKFSATPEEAMLAFLQPTLPAFSSGVKAVE
QGFDDIAAHQIAMVRGLEAGLGVVIDTLSPEATERAVGHVGGLGAIVSTARKAALWDGYR
RRHAEIRSRAEEDARSLFAEGFARGYATSHAALPMQRATPAEGGEARR
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgcggctcgtgatcgacatcgcccatcgcgacgatccggcaacccggatcgggccctcg
cggagcttcgaccgccgcggcctgcgtgtcggtcgcggcccggccaacgacgtggtgctg
gaagatccgacccgggtgatttccggccagcactgcctgatcgactatgacagcggccgg
ttccggctgatcgacaccagcaccaacggcagtttcgtgaacgatccgcgccggccggtg
ccgcgcgagaccggccatgtggtggccgatggcgaccgggtgttcgttggcgattacgtg
ctgacgctggggctgatgccggtgccggacgaggcgccggcaccccggccggcccggccg
ctgcatgcggcaccgaagccggtgcagcgccctgatccgggggcggccttctcgggcggc
gagccgccggccaccgccttcgccttcaccccgccccgcgtcgcccgggtcgagatcccg
gaagactgggatgccgacggccagaacctggacgggctgatggcggcccctgagaacgac
ccctcggacccgccggccccgccgatccgccgcccgccccaaccgccgagccaaccaccc
cggccgccgcgcgaccccgacccgatcccggtcgaggacccggaagacgtgccgctggag
gatccggtgccgatccgcgaccccgagccgctgcccgatccggacccggacgaggacccc
gaaccctatcgcgacccgccgccgcgccagaccccgccgccgtcggaataccggctgcgt
gacgaccggctctacgatgccttcctgtcgggcgccgggctgacccgcgagcagctgccg
ccttcccgcgccgaagaggtgctgcggaccgcgggcgaggtgttccgggcgacggcccgc
gggctgatcgagaccctgtcggcccgggccgagctgaagggcgaattccgcatcgagcgc
accaccatcaagccgcgcaacaacaacccgctgaaattctcggcgacgcccgaagaggcg
atgctggccttcctgcagccgaccctgccggccttctcgtcgggggtgaaggcggtggaa
cagggcttcgacgacatcgccgcccaccagatcgccatggtgcgcgggctggaagcgggg
ctgggcgtggtcatcgacaccctgtcgcccgaggcgaccgaacgcgcggtcggccatgtc
ggcgggctgggcgccatcgtctccaccgcccgcaaggccgcactctgggacggctatcgc
cgccgccatgccgagatccgcagccgcgccgaggaggatgcgcggtcgctgttcgccgaa
ggcttcgcccgcggctatgccacctctcacgctgccctcccgatgcagcgcgcgacaccg
gcggagggcggggaggcccggcgatga

DBGET integrated database retrieval system