KEGG   Tistrella mobilis: TMO_a0084Help
Entry
TMO_a0084         CDS       T02128                                 

Definition
(GenBank) type VI secretion system protein ImpG
  KO
K11896  type VI secretion system protein ImpG
Organism
tmo  Tistrella mobilis
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0084
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TMO_a0084
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_TssF
Motif
Other DBs
NCBI-ProteinID: AFK55487
UniProt: I3TRU9
Position
pTM1:complement(90375..92216)
Genome map
AA seq 613 aa AA seqDB search
MTDELLPHYQRELVEIRRRAGEFAAAHPKIAGRLRLTADAADDPFVARLIEAVAYLNARI
QLRLDDAFPELTDALLGVLHPHWLAPVPSMAIARFTPQADLSGPHTVPAGAELVTGPVAP
AEGRAPEPCRFRTAWPATLWPVEIETVALKARPVAAPAIAGVEQAVAVLKIGLRMTQPGR
SFTEIGLDRLRLFIAAPGAQAMRLYERLTNDVAGIAVAAGPEDPRPVRLGPDAVAPVGFA
GDEGLLPDDARTLPAYRLLTEYFAFPEKFLFLDLNGLDARTLAPTGDRLEIHVFLTRHDQ
DLERAVTAESFALGAVPIVNLFRQAAEPIRLDQRQSAYRVVPDARRPLSTEIFRILRVEG
SDSGGRRQLYQPFHSVAHGTAMADETRRWWHAERRPAGPRDPASEIYLSLVDDGFNPSEP
ATGVLSVDTLCLNRDLPARLPFGGGHPVLKPAEAMSAIRAVSCLTPPTRTLRPEAGARGR
WRLISFLSLNHLSLTDDTDGAAALRELLALHDLRDAPETRAAIDAITGISHRRGMARVPG
DRFGGMARGLDVTLELDPERYATGGLYLLAAVLDRVLGLYCTINSFTRLTAKLRGRPGVI
RTWPPRAGAQDLV
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgaactgcttccccattaccagcgcgagctggtcgagatccgccgccgggcg
ggcgagttcgcggcggcgcatcccaagatcgccgggcggctgcgcctgaccgccgatgcc
gccgatgacccgttcgtggcccggctgatcgaggcggtggcctatctgaatgcccgcatc
cagctgcggctggacgatgccttccccgagctgaccgatgcccttctgggggtgctgcac
ccgcactggctggcgccggtgccctcgatggcgatcgcgcggttcacgccgcaggcggat
ctttcggggccccataccgtcccggccggggccgagctggtgacgggacccgtggccccg
gccgaggggcgggcgcccgaaccctgccgcttccgcaccgcctggccagctaccctctgg
ccggtcgagatcgagaccgtggcgttgaaggcgcggccggtggcggcgccggcgattgcc
ggggtggagcaggcggtggcggtgctgaagatcgggctgcggatgacgcagcccgggcgc
agcttcaccgaaatcgggctggaccggctgcggctgttcatcgccgcccccggtgcccag
gcgatgcggctttacgagcgactgaccaatgatgtcgccggcatcgcggttgccgccggc
cccgaggatccgcggccggtgcggctcgggccggatgcggtggcgccggtgggttttgcc
ggggatgaggggctgctgcccgacgatgcccgcaccctgccggcctatcggctgctgacc
gaatatttcgccttccccgagaaattcctgttcctggacctgaacggccttgatgcccgc
acgctggcgcccaccggcgaccggctggagatccatgtcttcctcacccgccacgaccag
gatctggagcgggcggtgacggcggagagttttgcgctgggcgccgtgccgatcgtcaac
ctgttccgccaggccgccgagccgatccggctggatcagcgccagtctgcgtaccgggtg
gtgcccgatgcccgccggccgctctcgaccgagattttccggatcctgcgggtcgagggc
agcgattcaggcggccggcggcaactctatcaacccttccattccgtcgcccacggcacc
gccatggccgacgagacccggcgctggtggcatgccgagcgccggccggccgggccgcgc
gatcccgcgagcgagatctatctcagcctggtcgatgacggcttcaatccgtccgagccc
gctaccggcgtgctgtcggtcgacacgctgtgcctgaaccgcgacctgccggcgcggctg
cccttcggcggcggccatccggtgctgaaaccggccgaggcgatgtcggcgatccgggcg
gtgtcctgcctgaccccgcccacccggacgctgcgacccgaggcgggggcccgcggccgc
tggcggctgatttccttcctgtcgctcaaccatctgtcgctgaccgacgataccgacggg
gcggccgcgctgcgcgaactgctggcgctgcacgatctgcgcgacgcgcccgaaacccgg
gccgcgatcgatgcgatcaccggcatttcgcaccgccggggcatggcgcgcgtgcccggc
gaccgcttcggcggcatggcccgcgggttggatgtgacgctcgaactcgaccccgaacgc
tatgcgaccggcgggctctatctgctcgcggcggtgctcgaccgggtgttgggactttat
tgcacgatcaattccttcacccggctgaccgcgaaactgcggggccggccgggcgtcatc
cgcacctggccgccgcgcgcgggcgcgcaggatctggtctga

DBGET integrated database retrieval system