KEGG   Tistrella mobilis: TMO_a0087Help
Entry
TMO_a0087         CDS       T02128                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11899  type VI secretion system protein ImpD
Organism
tmo  Tistrella mobilis
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0087
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system related proteins
   TMO_a0087
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: VipB
Motif
Other DBs
NCBI-ProteinID: AFK55490
UniProt: I3TRV2
Position
pTM1:complement(93663..95063)
Genome map
AA seq 466 aa AA seqDB search
MSVSLPLQSAPPLRAPPLRATALRPLIDRVIALIDAAIGRQLDRILHHPRMQALEAAWRG
LALVVERAGRARSTKVRVLDVTWDMICRDFERAVEFDRAEMFAKIYEDEFGSPGGEPFGV
LIGAYELMHLRDADHPTDDVTGLKGMATVAAAAFAPFIAGAHPRLLGLDRFEALGRGFDP
GDFEGADHVRWRGLRMGEDARFLGLTCPRILLRHPWGEDPARIDGFRYVEDVSGPDAGKY
LWGVAAFAFALVLIRAHDATGWFADIRGAARDHELGGLVRELPADHFGTDRPDVGLKPPV
DVQLTDAQDKRLADLGLIALAPARDTPWVVFHGNPSLQLARPYDREAASANARLSAMLQY
MLCVSRFAHYVKVIGRDRVGSFSDAAACEEYLRRWLLGYSIASDTATPEQKARYPLRECA
VSVRESPGRPGIYDCTIHLRPHFQLDEVSSGFRLVTWFVARGLPQS
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atgtccgtctcgcttcccctccagagcgcccctccgcttcgtgcccctccgcttcgtgcc
acggcactgcggccgctgatcgatcgggtcatcgccctgatcgatgcggcgatcggccgg
cagctcgaccggatcctgcatcacccgcggatgcaggcgctggaagcggcctggcgcggc
ctggcgctggtggtggaacgggcgggccgggcgcggtcgaccaaggtgcgggtgctggac
gtcacttgggacatgatctgccgcgatttcgagcgcgcggtcgaattcgaccgtgccgag
atgttcgccaagatctacgaagacgagttcggcagccccggcggcgagcccttcggcgtg
ctgatcggcgcctatgagctgatgcatctgcgcgatgccgatcaccccaccgacgacgtc
accggcctcaagggcatggcgacggtggcggccgcggctttcgcgcccttcatcgccggt
gcccatccgcggctgctgggcctcgaccggttcgaggcgctgggccgcggcttcgatccg
ggcgatttcgagggcgcggatcatgtccgctggcggggtctcaggatgggcgaggatgcc
cgcttcctggggctgacctgcccgcggatcctgctccgccacccctggggcgaggatccc
gcccggatcgacggtttccgctatgtcgaggacgtgtcgggccccgatgccggcaagtat
ctgtggggggtggcggccttcgccttcgccctggtgctgatccgcgcccatgacgccacc
ggctggttcgccgacatccggggggccgcccgcgatcacgagctgggcgggctggtgcgc
gagctgccggccgatcatttcggcaccgaccgtccggatgtcgggctgaagccgccggtc
gacgtgcagctgaccgatgcccaggacaagcggctggcggatctggggctgatcgcgctg
gcgcctgcccgcgacacgccctgggtggtgtttcacggcaacccgtcgctgcagctggca
cggccctatgaccgcgaggcggcgagcgccaatgcccggctgtcggcgatgttgcaatac
atgctctgtgtcagccgtttcgcccattacgttaaggttatcgggcgggatcgcgtaggt
agtttctccgatgccgcggcctgcgaggaatatctccgccgctggctgctcggctattcg
atcgcgagcgacaccgcaacgccggaacagaaagcgcgctatccgcttcgggaatgtgcg
gtctcggtgcgcgagtcccccggtcgcccgggcatctatgactgcaccatccatctcagg
ccgcatttccagctggacgaggtgagttcgggctttcgcctggtcacctggttcgtggcg
cgggggctgccccagtcatga

DBGET integrated database retrieval system