KEGG   Tistrella mobilis: TMO_a0088
Entry
TMO_a0088         CDS       T02128                                 

Definition
(GenBank) type VI secretion system protein ImpC
  KO
K11900  type VI secretion system protein ImpC
Organism
tmo  Tistrella mobilis
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0088
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TMO_a0088
SSDB
Motif
Pfam: VipB VipB_2
Other DBs
NCBI-ProteinID: AFK55491
UniProt: I3TRV3
Position
pTM1:complement(95080..96576)
AA seq 498 aa
MSVIREESRAAEAGLAEAPVSLLDQAISATRQTDRDRAEELLRALTEEALKGTVRYSKNL
TQTIDRAIKAIDEKLSEQLGRIMHHEKFQKLEGSWRGMHHMVNFSETGRMLKIRMLNVSK
RELHRDLTRAVEFDQSQLFRKIYENEFGTPGGEPYGALIGDYEFTGEPEDMELLGQVSHV
SAAAFAPFISAASPKMFGFDDFTELTRPRDLEKIFESTEYTKWRSFRDSEDSRFVTLTMP
RVLARLPYGRHTRRVDAFDFEEAPLDERGLRKAMDHGDYCWMNAAYVMGTRLAEAFSMHG
WCTAIRGAEGGGKVEGLPFDTFVSDDGDPDAKCPTEVGITDRREAELSRLGFLPLCHYKN
TDYAVFFGAQTTQRPKTYDRPEATANAAISARLPYIMATSRFAHYLKVMGRDKIGSFMEA
EDCEAWLNRWVMNYVNANKDSGPDMKARYPLAEARVSVKEVPGAPGTYNAVAWLRPWLQM
EELTTSLRMVARIPGSGN
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgtccgtgatccgcgaagagagccgcgccgccgaagccggtcttgccgaggccccggtc
tcgttgctcgaccaggcgatttccgccacccgccagaccgatcgcgaccgcgcggaggaa
ctgctgcgcgcgctgaccgaagaggcgctgaagggcaccgtccgctattccaagaacctg
acccagaccatcgaccgcgcgatcaaggcgatcgacgagaagctgtcggaacagctgggc
cggatcatgcatcacgagaaattccagaagctggaaggctcgtggcgcggcatgcaccac
atggtcaacttctccgagaccgggcgcatgctgaagatccgcatgctgaacgtgtcgaag
cgagagctgcaccgcgacctgacgcgggcggtggaattcgaccagagccagctgttccgc
aagatctacgagaacgaattcggcacccccggcggcgagccctatggcgcgctgatcggc
gattacgaattcaccggcgagccggaagacatggaactgctgggtcaggtctcccacgtc
tcggcggcggccttcgcgccattcatctcggcggcgtcgccgaagatgttcggcttcgac
gacttcaccgagctgacccgcccgcgcgacctggagaagatcttcgaatcgaccgaatac
accaagtggcgcagcttccgcgacagcgaggacagccgcttcgtgacgctgaccatgccg
cgggtgctggcgcgcctgccctacgggcggcacacgagacgggtcgatgcctttgatttc
gaagaggcgccgctggacgagcgcggcctgcgcaaggccatggatcacggcgactattgc
tggatgaacgcggcctatgtgatgggcacgcgcctggccgaggccttctcgatgcatggc
tggtgcacggcgatccgcggcgccgagggcggcggcaaggtcgagggcctgcccttcgac
accttcgtttccgacgacggcgatccggatgccaaatgcccgaccgaggtcggcatcacc
gaccgccgcgaggccgagctgtcgcggctgggcttcctgccgctctgccattacaagaac
accgactatgcggtgttcttcggcgcccagaccacccagcggcccaaaacctatgaccgg
cccgaagcgaccgccaatgccgcgatctcggcccggctgccctatatcatggccacctcg
cgcttcgcccattacctgaaggtcatgggccgcgacaagatcggctcgttcatggaggcc
gaggattgcgaggcctggctgaaccgctgggtgatgaactacgtcaacgccaacaaggac
agcggcccggacatgaaggcccgctatccgctggccgaggcgcgggtgtcggtgaaggaa
gtccccggtgcccccggcacctacaacgccgtcgcctggctccggccctggctgcagatg
gaagagctgacgacctctctgcgcatggtcgcccgcatccccggcagcggcaactga

DBGET integrated database retrieval system