KEGG   Tistrella mobilis: TMO_a0089
Entry
TMO_a0089         CDS       T02128                                 

Definition
(GenBank) type VI secretion protein
  KO
K11901  type VI secretion system protein ImpB
Organism
tmo  Tistrella mobilis
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0089
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TMO_a0089
SSDB
Motif
Pfam: T6SS_VipA
Other DBs
NCBI-ProteinID: AFK55492
UniProt: I3TRV4
Position
pTM1:complement(96582..97115)
AA seq 177 aa
MSATSIHEKLNRVRKPRVHITYQVETEGAVVDKELPFVIGVLGDFSGDPDPDRPLAPLRD
RKFVQIDRDNFDDVMARIAPHLDLRVENTLAGDGSEMAVHLNFTSLDDFEPGAVVRQVEP
LRRLLETREKLRDLMGKVDRSEELEELLERVLQDDARLAELSDALGVRAPADSKPGE
NT seq 534 nt   +upstreamnt  +downstreamnt
atgtccgcgaccagtatccatgaaaagctgaaccgggtgcgcaagccccgggttcacatc
acctaccaggtcgagaccgaaggcgccgtcgtcgacaaggaactgcccttcgtcatcggc
gtgctgggcgatttctcgggcgatcccgatcccgaccggccgctggcgccgctgcgcgac
cgcaaattcgtgcagatcgaccgcgacaatttcgacgacgtcatggcccggatcgcgccg
catctggacctgcgcgtcgagaacacgctggccggcgacggcagcgagatggcggtgcat
ctgaatttcaccagcctggacgatttcgagccgggcgcggtggtgcgccaggtggagccg
ctgcgccggctgctggaaacgcgcgagaagctgcgtgacctgatgggcaaggtcgaccgc
tcggaagagctggaagagctgcttgaacgcgtgctgcaggacgatgcccggctggccgag
ctgtcggatgccctgggtgtgcgcgcccccgccgacagcaagcccggggagtaa

DBGET integrated database retrieval system