KEGG   Tistrella mobilis: TMO_a0092Help
Entry
TMO_a0092         CDS       T02128                                 

Definition
(GenBank) hypothetical protein
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
tmo  Tistrella mobilis
Pathway
tmo03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    TMO_a0092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tmo02044]
    TMO_a0092
Secretion system [BR:tmo02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   TMO_a0092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP Mfa_like_2
Motif
Other DBs
NCBI-ProteinID: AFK55495
UniProt: I3TRV7
Position
pTM1:99418..99891
Genome map
AA seq 157 aa AA seqDB search
MIYLNIEGIQGDATHETHKNWIDVSSMTWGTHRAVSTPSGSAQNREASEPVIGEVHITKL
MDGSSLKLFEAAATGNQGKQIQIHLVTTGNPGNTYMEYTLTDTLVSGYQINTSGDRPVEE
ITLNFTRVDMKYTTYDANNRPLNNIAAGYDIATTRKS
NT seq 474 nt NT seq  +upstreamnt  +downstreamnt
atgatctatctgaatatcgagggaattcagggtgacgccacccacgagacccacaagaac
tggatcgacgtgtcgtcgatgacctggggcacccaccgggcagtctccaccccctctggt
tcggcccagaaccgcgaagcctcggagccggtgatcggcgaagtgcacatcaccaagctg
atggacggttcgtcgctgaagctgttcgaggccgccgccaccggtaatcagggcaagcag
atccagatccacctggtcaccacgggcaatcccggcaacacctacatggaatacaccctc
accgacacgctggtgagcggctaccagatcaatacttcgggcgatcgcccggtcgaggaa
atcacgctgaacttcacccgcgtggacatgaagtacaccacctatgatgccaacaaccgg
ccgctgaacaacatcgccgccggctacgacatcgccaccacccggaagtcctga

DBGET integrated database retrieval system