KEGG   Tistrella mobilis: TMO_c0270Help
Entry
TMO_c0270         CDS       T02128                                 

Definition
(GenBank) diheme cytochrome c SoxE
  KO
K08738  cytochrome c
Organism
tmo  Tistrella mobilis
Pathway
tmo02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    TMO_c0270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: AFK56880
UniProt: I3TVU2
Position
pTM3:294776..295147
Genome map
AA seq 123 aa AA seqDB search
MKMIGRVVLGLVSVLAATAPTRADPERGQTLFAACAACHETGPASSRRAPSLKGIIGRPA
GSLADFRYSRAMSQSGIVWTDETIRKFIQSPQGFIPGNRMPFSGIPSEADRADIVDYLKS
ISG
NT seq 372 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgatcggcagggtcgtcctgggtctggtgtcggttctggccgccactgccccc
accagggccgatccggaacgggggcagacgctcttcgccgcatgcgccgcctgtcatgag
acgggccccgccagcagccggcgggccccgagcctgaagggcatcatcgggcgacccgcc
ggaagcctggctgatttccggtacagccgggcaatgagccagagcggaattgtctggacc
gacgagacgattcgcaaattcattcagtcgcctcaaggctttatcccgggaaacaggatg
ccgttctccggaataccatccgaagccgacagggcggatatcgtcgattacctgaagagt
atttcaggctag

DBGET integrated database retrieval system