KEGG   Tistrella mobilis: TMO_c0670Help
Entry
TMO_c0670         CDS       T02128                                 

Gene name
thrC
Definition
(GenBank) threonine synthase-like protein
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
tmo  Tistrella mobilis
Pathway
tmo00260  Glycine, serine and threonine metabolism
tmo00750  Vitamin B6 metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01230  Biosynthesis of amino acids
Module
tmo_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tmo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TMO_c0670 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    TMO_c0670 (thrC)
Enzymes [BR:tmo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     TMO_c0670 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Raftlin DFP
Motif
Other DBs
NCBI-ProteinID: AFK57280
UniProt: I3TWZ2
Position
pTM3:complement(795088..796344)
Genome map
AA seq 418 aa AA seqDB search
MAGYACLRCGAAYPADHPIDSRGCGICRRDAPSNLEVAYTAESLARRTMPQMSPADGLAA
FADYLPVDADEMVSLGEGHTPLIPAARLGRRLGIGNLLIKDESRNPTWSHKDRFSAVAVS
AAKRQGHRFVATASSGNAGASLAAYAARAGLTCLVVTFEGAPGPMVDQIGRYGAVVVELA
DKTRRWPILAEGVARFGWFVTSPFETPVVGSHPDGIEGYKTIACELVLQQQGRVPDWVVV
PTAYGDNLRGIWRGFCDLRAAGVIDRLPKMVAAEIHGSVRDSLARPADTLVTARDPFPTR
ALSIGTVQGTFQSLVSVRRSGGTAEVVTDAALWQTQAGLARHEGIFGELSGVTSIAAAGQ
LRRRGIIGPDDSVVCIMTASGLKDIDQRPPHPATRYRVTGGLDEVLKHLTAEFGAGPA
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
gtggccggctatgcctgcctgcgctgtggcgcggcatatcctgcggatcatccgatcgat
tccaggggctgcgggatctgcagacgcgatgccccgtctaatctggaggtggcctatact
gcggaaagcctcgcccggcggacgatgccgcagatgtcgcccgcagacgggctcgccgcc
ttcgctgattatctgccggtcgatgcggacgagatggtgagcctcggcgaggggcacaca
ccgctgatcccggcggcccggctgggccggcgtctcgggatcggaaatcttctgatcaag
gatgagagccgcaaccccacctggtcgcacaaggaccggttttcggcggtggccgtgtcg
gccgcgaaacggcagggccatcggttcgtggcgaccgcgtcgtccggcaatgccggggcg
tcgctggctgcctatgccgccagagccgggctcacctgtctggtggtgaccttcgagggc
gcgccgggaccgatggtcgatcagatcggccgctacggcgccgtggtggtcgagcttgcc
gacaagaccaggcgctggccgatcctggccgagggggtcgcgcgcttcggctggttcgtg
acctcgcccttcgagacgccggtggtgggcagccatcccgacggcatcgaaggctacaag
accattgcctgtgaactcgtcctgcagcagcaggggcgggtgcccgactgggtcgtggtc
ccgaccgcctatggcgacaatctccgcggcatctggcgggggttctgcgatcttcgcgcg
gcgggggtcatcgaccgcctgccgaagatggtcgcggccgagatccatgggtcggtccgc
gacagccttgcccggccggccgatacgctcgtcacggcccgggacccgtttccgacccgg
gcgctgtccatcggcacggtgcaggggactttccagtcgctggtctcggtgcgccggtcg
ggcgggacggcagaggttgtgacggatgcagcgctctggcagacccaggccggtcttgcc
cgtcacgaaggcatcttcggcgaattgtcgggggttacctcgatcgcggcggccggtcag
ctgcgccggcgcgggatcatcggtccggatgacagcgtggtctgtatcatgaccgcaagc
gggctcaaggacatcgaccagcggccgccgcatcccgcgacgcgctacagggtcaccggt
gggctggacgaggtgttgaaacacctgacggcggaattcggtgccggcccggcctga

DBGET integrated database retrieval system