KEGG   Tistrella mobilis: TMO_c0853Help
Entry
TMO_c0853         CDS       T02128                                 

Gene name
acoC
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
tmo  Tistrella mobilis
Pathway
tmo00010  Glycolysis / Gluconeogenesis
tmo00020  Citrate cycle (TCA cycle)
tmo00620  Pyruvate metabolism
tmo01100  Metabolic pathways
tmo01110  Biosynthesis of secondary metabolites
tmo01120  Microbial metabolism in diverse environments
tmo01130  Biosynthesis of antibiotics
tmo01200  Carbon metabolism
Module
tmo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tmo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TMO_c0853 (acoC)
   00020 Citrate cycle (TCA cycle)
    TMO_c0853 (acoC)
   00620 Pyruvate metabolism
    TMO_c0853 (acoC)
Enzymes [BR:tmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     TMO_c0853 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Abhydrolase_5 Thioesterase PGAP1 Biotin_lipoyl_2 PDZ_4 Ndr Ser_hydrolase Esterase
Motif
Other DBs
NCBI-ProteinID: AFK57463
UniProt: I3TXH5
Position
pTM3:1010805..1011917
Genome map
AA seq 370 aa AA seqDB search
MSDDRIKPLVMPKWGLSMQEGRLAAWLVEEGADISVGDEIMEVETDKITNVVEAADAGRL
RRRVGQEGEVYPVKALLGVLAPPEVDDAAIDAFVAAYEVPAAGGDDEDATPAHAFVDTPA
GRLRHASRGEGGPHVVLIHGFGGDLDNWLFNIDDLAAAARVHALDLPGHGQSSKDVGAGD
LDALTDAVLAFMDSQDIEAAHLVGHSMGGAVSARLATTRPERARSLTLIASAGLGDDIDQ
GYIDGFVTAASRRDLKPVLSKLFADQALVGRRLVDDLLKYKRLDGVDAALAKLRDGLFAG
GRQKTPLAGAIAAADLPVLVIWGTEDRVIPAAHATAVPGATVEVLPDAGHMVQMEAAARV
NELIRRHIGG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgagtgacgaccgcatcaagccgctggtcatgccgaaatggggcctgtccatgcaggag
ggccgccttgccgcctggctggtcgaggaaggggccgacatctcggtcggcgacgagatc
atggaggtcgagaccgacaagatcaccaatgtcgtggaggcggccgatgccggccgtctc
cgccgccgggtcgggcaggagggcgaggtctacccggtgaaggcgctgctgggcgtgctg
gcgccgcccgaggtggacgacgccgcgatcgatgccttcgtcgccgcctatgaggtgccg
gcggcgggcggcgatgacgaggacgccacccctgcccatgccttcgtcgacaccccggcc
ggccggctgcgccatgccagccgcggcgagggcggcccccatgtcgtgctgatccacggc
ttcggcggcgatctcgacaactggctgttcaacatcgacgatctggccgccgctgcccgg
gtccatgccctcgacctgccgggccatggccagtcgtccaaggatgtgggcgcgggtgat
ctggatgcgctgaccgacgcggtgcttgccttcatggacagccaggatatcgaggcggcg
catctggtcggtcattccatgggcggtgcggtctcggcgcgcctcgccacgacaaggccg
gagcgcgcccgctccctgacgctgatcgcctcggctgggctgggggacgacatcgaccag
ggctatatcgacggcttcgtcaccgcggcctcgcgccgcgacctcaaacccgtgctctcg
aaactcttcgccgaccaggccctggtcgggcggcggctggtcgacgatctgctgaaatac
aaacgcctcgacggggtcgatgcggcactggcgaagctccgcgacgggctgttcgcgggc
ggccgccagaagaccccgctcgccggtgccatcgccgctgccgatctgccggtgctggtg
atctggggcacggaggaccgggtgatcccggccgcccatgccactgccgtgcccggggcc
acggtcgaggtcctgcccgatgccggccacatggtccagatggaagcggctgcccgggtc
aacgaattgatccggcgccatatcggaggatga

DBGET integrated database retrieval system