KEGG   Thermotoga maritima Tma100: THMB_0124Help
Entry
THMB_0124         CDS       T03900                                 

Definition
(GenBank) oxaloacetate decarboxylase
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tmq  Thermotoga maritima Tma100
Pathway
tmq00620  Pyruvate metabolism
tmq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    THMB_0124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmq02000]
    THMB_0124
Enzymes [BR:tmq01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     THMB_0124
Transporters [BR:tmq02000]
 Other transporters
  Primary active transporters [TC:3]
   THMB_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Ribosomal_L12_N
Motif
Other DBs
NCBI-ProteinID: AKE29807
Position
complement(134263..135651)
Genome map
AA seq 462 aa AA seqDB search
MFVDTTLRDGHQSLIATRMRTEDMLPALEAFDRMNFHSMEVWGGATFDVAVRFLNENPWE
RLKKIREGLKNTKIQMLLRGQNLVGYRHYADDVVELFIKKVAEYGLDIIRIFDALNDERN
LQKSIEESKKHGLHVQVAISYTVSPVHTLDYYLDFARKLLDMGVDSICIKDMAGLLTPKR
AYELVRALKEKFGVPVEVHSHCTTGFAPLAYQAAYEAGADFFDTAISPFSMGTSQPTFET
MYYAFRGNGKEDFDREALKFLVDHFTKVRMKYIEYDVGMKYPDSRIIFSQIPGGMYSNLL
KQLKEQRMEHLLDKVLEEVPRVQKDLGYPPLVTPTSQIVGVQAFLNVVYGRYERITNETR
NYVKGLYGRPPAPIDPELMRKILGDEKPIDCRPADLLEPELDKTRKELGILVETDEDLLI
AVILGEVGKKFLRKKYEEKIGVDFNYLESLSDFTDDMPVYPV
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgttcgttgatacaaccttaagagatggacatcaatctctgatcgcgacgaggatgaga
acggaagatatgctgcctgctctcgaagcgttcgacagaatgaattttcactccatggaa
gtctggggaggagcaaccttcgatgtcgccgttagatttctgaacgaaaatccatgggag
aggttgaaaaagataagagagggtttgaagaacacgaagattcagatgcttctgagagga
cagaatctcgttggctacaggcactacgcggacgatgttgtggagcttttcataaagaaa
gtggcggagtatggactggatatcatacgtatcttcgatgcgctgaacgatgaaagaaac
ctgcagaaatctattgaagagtcaaaaaagcacggtcttcatgttcaggtagcgatcagt
tacacggtgagtcctgtccacactctcgattactatcttgacttcgcaagaaaacttctg
gatatgggagtggactcgatttgtataaaggacatggcggggcttctcactccaaaaagg
gcttacgaactcgtcagggctttgaaagagaagttcggtgttcccgttgaggtccactct
cactgtaccacaggctttgctccccttgcgtatcaagcggcttacgaagcaggggcggat
tttttcgatacggctatttctccgttttccatgggaacgtctcagccaacttttgaaacc
atgtattacgctttcagaggaaacggaaaagaggattttgacagagaagcgctgaagttt
ctggtggatcatttcacgaaggtgagaatgaaatacatcgagtacgatgtggggatgaag
tatccagattcgaggatcatattctcgcagattcccggtggtatgtactccaaccttctc
aagcagctgaaagagcagaggatggaacacttgcttgataaggtgctcgaggaggttcca
agggtccaaaaagacctcggttatccaccactcgttacaccaacgagtcagatcgtgggt
gttcaggcgtttctcaacgtggtctatggtagatacgagcggataaccaacgaaacgagg
aattatgtgaaaggactctatggtaggccacccgcaccgatcgatccagaactgatgaga
aagattcttggtgatgagaaacccatagattgcagacctgctgatcttttggaacccgaa
ctggacaaaacaaggaaagaattgggaattcttgttgaaacggacgaagaccttctcatc
gctgtgatcctgggagaggtaggcaagaaatttttgaggaagaagtacgaggagaagatc
ggcgtggacttcaactatctcgaatctctctctgactttaccgatgacatgccggtgtat
ccagtgtaa

DBGET integrated database retrieval system