KEGG   Thermaerobacter marianensis: Tmar_0274Help
Entry
Tmar_0274         CDS       T01388                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00071  Fatty acid degradation
tmr00072  Synthesis and degradation of ketone bodies
tmr00280  Valine, leucine and isoleucine degradation
tmr00310  Lysine degradation
tmr00362  Benzoate degradation
tmr00380  Tryptophan metabolism
tmr00620  Pyruvate metabolism
tmr00630  Glyoxylate and dicarboxylate metabolism
tmr00640  Propanoate metabolism
tmr00650  Butanoate metabolism
tmr00900  Terpenoid backbone biosynthesis
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01200  Carbon metabolism
tmr01212  Fatty acid metabolism
tmr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:tmr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmar_0274
   00630 Glyoxylate and dicarboxylate metabolism
    Tmar_0274
   00640 Propanoate metabolism
    Tmar_0274
   00650 Butanoate metabolism
    Tmar_0274
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Tmar_0274
   00072 Synthesis and degradation of ketone bodies
    Tmar_0274
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Tmar_0274
   00310 Lysine degradation
    Tmar_0274
   00380 Tryptophan metabolism
    Tmar_0274
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmar_0274
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Tmar_0274
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Tmar_0274
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tmr04147]
    Tmar_0274
Enzymes [BR:tmr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Tmar_0274
Exosome [BR:tmr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tmar_0274
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III Ketoacyl-synt_C SpoVAD
Motif
Other DBs
NCBI-ProteinID: ADU50399
UniProt: E6SMD9
Position
317533..318705
Genome map
AA seq 390 aa AA seqDB search
MIIDGARTPFGKFGGALKDVPAVELGAVAIRAALDRAGVAPEQVDYVLMGMVVQAGAGQI
PSRQAAVKAGLPVTVPSDTINKVCASALRAVNLGDALIRAGDAAVVVAGGMESMSQAPYL
ARQARWGGRMGHLQLEDALLTDGLLCAFGGCHMGVYGSRVAAEYGVTREEQDRWALRSHQ
RAIAAMDAGRLAEEIVPVQVPGRKGEVTRVEVDEAPRRDTSYEKLAALPPVFEQDGTVTA
GNAPGLNDGAAALVLMEAERARALGLKPLATIVSQGQASLDPPYLHTVPYYAAERALKKA
GLRWDDIALFEVNEAFAAVALTTMKLGNWDPEKVNVNGGAVALGHPIGASGARILLTLAY
ELRRRGGGYGIATICSGGGQGEATLIRVDG
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatcgacggggcgcgcacgcccttcggcaagttcggcggcgccctcaaggacgtg
ccggcggtggagctgggggccgtggccatccgcgcggccctggaccgggcgggtgtggcc
cccgagcaggtggactacgtgctgatgggcatggtcgtccaggcgggggcgggccagatc
ccctcccggcaggcggccgtcaaggcgggtctgcccgtgacggtgccgtcggacaccatc
aacaaggtgtgtgcctccgccctgcgggcggtgaacctgggcgacgccctgatccgcgcc
ggcgacgccgcggtggtggtggcgggcggcatggagagcatgagccaggcgccgtacctg
gcccgccaggcccgctggggcggccgcatgggccacctgcagctggaggatgccctgctc
accgacgggctgctctgcgccttcggcggctgccacatgggcgtctacggcagccgcgtg
gcggccgagtacggcgtgacccgggaggaacaggaccgctgggcgctgcgcagccaccag
cgggccatcgccgccatggacgccggccggctggcggaagagatcgtacccgtccaggtg
cccggtcgcaaaggcgaggtgacccgcgtcgaggtggacgaggcgccgcgccgcgacacc
agctacgagaagctggccgccctgccgccggtcttcgagcaggacggcacggtgacggcg
ggcaacgctccgggcctcaacgacggcgccgccgccctggtgctgatggaggccgagcgg
gcccgcgccctggggctcaagcccctggccaccatcgtcagccagggccaggcgtccctg
gacccgccctacctgcacaccgtcccgtactacgccgccgagcgggccctcaagaaggcc
ggcctgcgatgggacgacatcgccctcttcgaggtcaacgaagccttcgccgccgtggcc
ctgaccacgatgaagctgggcaactgggaccccgagaaggtgaacgtcaacggcggcgcc
gtggccctgggccaccccatcggcgccagcggcgcccgcatcctgctgaccctggcctac
gagctgcgccgccgcggcggcggctacggcatcgccaccatctgcagcggcggcggccag
ggcgaggcgacgctgatccgcgtcgacgggtga

DBGET integrated database retrieval system