KEGG   Thermaerobacter marianensis: Tmar_1070Help
Entry
Tmar_1070         CDS       T01388                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
tmr  Thermaerobacter marianensis
Brite
KEGG Orthology (KO) [BR:tmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tmar_1070
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Tmar_1070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP PHP_C
Motif
Other DBs
NCBI-ProteinID: ADU51183
UniProt: E6SK42
Position
1295998..1296843
Genome map
AA seq 281 aa AA seqDB search
MKGGADLHTHTTASDGTVTPEERIRMAVAAGLEWVGITDHDTLAGLPAAREAARAAGIGL
VPGVELSTDVDLGTRRVGVHVLGYWVHEDDAPLVELLARRRAAREQRLARMLERLAAAGI
VLDEARVRSLAAGGAVGRPHVARALVEAGVVATVAEAFEKYLTPGKPGYVPRAPLAPEAA
IAAIREAGGVPVLAHPGLLPQQLFNLWPAWKRQGLAGVEVYHSKHSPEQAQAFLARAREL
DLVPTGGSDCHGPQPGQPPLIGRVRVPAEWVERLRQRAAAD
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgaagggcggcgccgatctccacacccacaccacggcctccgacggcacggtgaccccg
gaggagcgcatccgcatggccgtggcggcgggactggagtgggtgggcatcaccgaccac
gacaccctggccggcctgccggcagcacgggaggccgcccgggctgccggcatcggcctg
gtgccgggggtcgagctcagcaccgacgtggacctgggcacgcggcgggtgggcgtccac
gtcctggggtactgggtccacgaggacgatgcgccgctggtcgagctgttggcccggcgg
cgcgcggcgcgggagcagcggctggcccgcatgctcgagcggctggccgcggccgggatc
gtcctcgatgaggcgcgggtgcggtcgctggcggcgggcggcgccgtgggccggccccat
gtggcccgggccctggtggaggccggcgtggtggcgaccgtggcggaggccttcgagaag
tacctcacgcccggcaagccgggatacgtgccccgggccccgctggctccggaggcggcc
atcgccgccatccgcgaggcgggcggcgtgccggtgctggcccaccccggtctgctgccc
caacagctcttcaacctctggccggcctggaagcggcagggcctggcgggcgtggaggtc
taccacagcaagcacagcccggagcaggcccaggcgttcctggcgcgggcgcgggagctc
gacctggtgccgacgggcgggtccgactgccacggcccccagcccggccagccgccgctc
atcggccgggtgcgggtgccggcggagtgggtggagcggctgcgccagcgggcggcggcg
gactga

DBGET integrated database retrieval system