KEGG   Thermaerobacter marianensis: Tmar_1361Help
Entry
Tmar_1361         CDS       T01388                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00300  Lysine biosynthesis
tmr01100  Metabolic pathways
tmr01120  Microbial metabolism in diverse environments
tmr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tmar_1361
Enzymes [BR:tmr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Tmar_1361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADU51474
UniProt: E6SMB5
Position
complement(1633320..1634579)
Genome map
AA seq 419 aa AA seqDB search
MRCVTVNGQGASRFGPAPDPGGLRDLVPRLAAALPRQATVELARDLIRAVTVNPPGHEDR
AAAVAVPWLQRHGFDVTIYAPRPGRASVVARRRGAEPGPTLLWCGHLDVVAAGDPGRWPH
PPFAGVVDGDRLYGRGAVDMKGPVAAALGAAAALDRLGGPRRGTLVLALVADEEAMGRHG
AGWLARQGLLRADGAIVGEPTRLHLVRAQRGAAWFHVRLEGRTAHAAVPHLGASAVAAAA
RLVLALEERVWDAFHPLLGPPTASVGSIRGGDHPNRVPERCELVVDRRAVPGETEAGVRQ
EVEAVVAEVLRRHPGVTATITRWRWAEPAETPEDAAVVRLVQAAARAVTGEDPPEAGTVA
VTDMRYLVAAGTPAVIFGPGRPDLAHAPGEFIAVEELAQGALLYATAFAGWLGVAGTGR
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
gtgaggtgcgtgacggtgaacgggcaaggggcctcccgtttcgggccggcccccgacccc
ggcgggctgcgggacctggtgccccgcctggcggcggccctcccgcgccaggcgaccgtc
gagctggcgcgggatctgatccgggccgtgaccgtcaacccgccgggtcacgaggaccgg
gcggccgcggtggcggtgccctggctccagcgccacggctttgacgtgacgatctatgcc
ccgcggccgggccgggccagcgtggtggcccgccgccggggtgccgagccgggccccacc
ctgctctggtgcgggcacctggacgtggtggcggcgggcgaccccggccgctggccccac
ccgccctttgcgggggtggtggacggggaccggctttacggccgcggggccgtggacatg
aaggggcccgtggccgcggccctgggggccgccgccgccctcgaccggttgggcggcccc
cggcggggcaccctggtgctggccctggtggccgacgaggaggccatgggccgtcacggc
gccggctggctggcccgccagggcttgctccgggccgacggggccatcgtcggcgagccc
acgcgcctgcacctggtgcgggcccagcgcggcgccgcctggttccacgtgcgccttgag
ggccggaccgcccatgccgcggtgccccacctgggcgccagcgccgtggccgccgccgcc
cggctggtgctggccctggaggagcgggtctgggatgccttccacccgctgctggggccg
cccacggccagcgtcggcagcatccgcggcggggatcaccccaaccgggtgccggaacgg
tgcgagctggtggtcgaccggcgggcggtgccgggggagacggaggccggcgtccggcag
gaggtggaggcggtggtggccgaggtgctgcggcggcatcccggcgtcaccgcgaccatc
acccgctggcgctgggcggaaccggcggagacgcccgaggatgccgccgtggtccggctg
gtgcaggccgcggcccgggcggtgacgggtgaggacccgccggaggcgggcaccgtggcg
gtgaccgacatgcggtacctggtggcggcggggacgcccgcggtgatcttcgggcccgga
cggccggatctggcccacgcacccggcgagttcatcgccgtggaggaactggcccagggc
gccctgctgtacgccaccgccttcgccgggtggctgggtgtggcggggaccgggcgatag

DBGET integrated database retrieval system