KEGG   Thermaerobacter marianensis: Tmar_1483Help
Entry
Tmar_1483         CDS       T01388                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00010  Glycolysis / Gluconeogenesis
tmr00620  Pyruvate metabolism
tmr00640  Propanoate metabolism
tmr00680  Methane metabolism
tmr01100  Metabolic pathways
tmr01110  Biosynthesis of secondary metabolites
tmr01120  Microbial metabolism in diverse environments
tmr01130  Biosynthesis of antibiotics
tmr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tmar_1483
   00620 Pyruvate metabolism
    Tmar_1483
   00640 Propanoate metabolism
    Tmar_1483
  Energy metabolism
   00680 Methane metabolism
    Tmar_1483
Enzymes [BR:tmr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Tmar_1483
Lipid biosynthesis proteins [BR:tmr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Tmar_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADU51596
UniProt: E6SGE4
Position
1781863..1783824
Genome map
AA seq 653 aa AA seqDB search
MGEGPSGAVPAALSGMNPLVRRRVEEGLEDWEAFWAREARRLPWFRLWDRVFQPDPPSFR
WFVGGLTNLAYNALDVHVDRDWGGHAALIALNERGERQVFTYAQLWHRVRQVAAALRGLG
LQRGDRVAIYMPTIPEAICTMLACARIGAIHMVVFAGFGSAALAQRIQLAGARVLVTADV
TWRKGREVNLWDLAREALASPGCPVERVVVLARSGRDLPLVPGRDMTWDQFLSLAADGSP
EVEVMEANEPAFILATSGTTAQPKLVVHSQGPYQVGVYNAATMGFGLRPGDVWWSTSDIG
WIVGHGYIVYGPLLVGCTTIAYEGALDYPGPETFYRILEENRVTGVFTAPTAVRMLMAYG
TEPARRFDLRSVERVFCAGEVLNPPAWDWLQNQVFGGRVPVIDHWWQTETGAPVIGNPYG
IGLLPIKPGSAGIALPGRQVEVRTPEGDPCGPGEKGVLVIPRPFPGLAAGLWGDPERYAN
DYWGRIPGLYFTGDAATMDEDGYVWFSGRSDELIKIAGHRIGTIEVETAFLRHPAVAEAG
VTARPDPVRGEVIVAFIVLKKGHEPSAALRDELVATVRHHLGPVAVIGNVHFVPMLPKTR
SGKIMRRVLKAVVLDRDPGDISTIEDEGAVEQARQAWQAMQASIGAEAEAAGR
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagggccttccggcgccgtcccggccgccctgtccgggatgaacccgctggtt
cggcgccgcgtcgaagagggcctggaggattgggaggccttctgggcccgcgaagcgcgc
cggctgccctggttccgcctgtgggaccgggtcttccagccggacccgccgtccttccgc
tggttcgtgggcggcctcaccaacctggcctacaacgccctggacgtccacgtggatcgg
gactggggcggccacgccgccttgatcgccctgaacgagcggggcgagcgccaggtgttc
acctacgcccagctctggcaccgggtgcggcaggtggccgcggccctgcggggcctcggc
ctgcagcggggggaccgggtggcgatctacatgcccaccatccccgaagccatctgcacc
atgctggcctgcgcccggatcggcgccatccacatggtggtcttcgccgggttcggcagc
gcggccctggcccagcgcatccagctggcgggggcgcgggtgctggtgacggcggacgtc
acctggcgcaagggccgggaggtcaacctctgggacctggcccgcgaggccctggcgagc
cccggctgccccgtcgagcgggtggtggtgctggcccgcagcggccgcgacctgcccctg
gtgcccggccgggatatgacctgggaccagttcctctccctggccgccgacggctcgccc
gaggtggaggtcatggaggccaacgagcccgccttcatcctggccacgtcggggaccacg
gcccagcccaagctggtggtccacagccaggggccgtaccaggtcggcgtgtacaacgcg
gccaccatgggcttcggcctgcggcctggcgacgtgtggtggtccacttccgacatcggc
tggatcgtcgggcacggctacatcgtctacgggccgcttctggtcggatgcaccaccatc
gcctacgagggggccctcgactaccccggccccgagaccttctaccggatccttgaggag
aaccgggtgacgggagtcttcaccgcgcccacggcggtgcggatgctgatggcctacggc
accgaaccggcccgccggttcgacctacgttcggtggagcgggtgttctgcgcgggagag
gtgctcaacccgccggcctgggattggttgcagaaccaggtcttcggcgggcgggtgccc
gtcatcgaccactggtggcagacggaaacgggggcaccggtgatcggcaacccctacggc
atcggcctgctgcccatcaagccgggctcggcgggcatcgccctgccggggcgccaggtg
gaggtgcggacgcccgagggcgacccctgcggccccggagagaagggcgtcctggtgatc
ccacggcccttccccgggctggcggcggggctctggggcgatccggagcggtacgccaac
gactactggggccgcatccccggcctgtacttcaccggcgacgccgcgaccatggacgag
gacgggtacgtctggttcagcggccgctccgacgagctgatcaagatcgccggccaccgc
atcggcaccatcgaggtggagacggccttcctgcgccatcccgccgtggccgaggcgggg
gtgacggcccggcccgacccggtgcggggggaggtgatcgtcgccttcatcgtgctgaag
aagggccacgagccgtccgccgccctgcgggacgagctggtggccacggtgcggcaccac
ctgggcccggtggccgtgatcggcaacgtgcacttcgtgcccatgctccccaagacccgc
agcggcaagatcatgcggcgggtgctcaaggcggtggtgctggaccgcgatcccggcgac
atctcgaccatcgaggacgagggggcggtcgaacaggcccgccaggcgtggcaggccatg
caggcgagcatcggcgcggaggcggaagcggcaggacgatga

DBGET integrated database retrieval system