KEGG   Thermaerobacter marianensis: Tmar_2021Help
Entry
Tmar_2021         CDS       T01388                                 

Definition
(GenBank) 4-hydroxythreonine-4-phosphate dehydrogenase
  KO
K22024  4-phospho-D-threonate 3-dehydrogenase / 4-phospho-D-erythronate 3-dehydrogenase [EC:1.1.1.408 1.1.1.409]
Organism
tmr  Thermaerobacter marianensis
Brite
KEGG Orthology (KO) [BR:tmr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Tmar_2021
Enzymes [BR:tmr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.408  4-phospho-D-threonate 3-dehydrogenase
     Tmar_2021
    1.1.1.409  4-phospho-D-erythronate 3-dehydrogenase
     Tmar_2021
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PdxA TraH_2
Motif
Other DBs
NCBI-ProteinID: ADU52102
UniProt: E6SJ78
Position
2432134..2433297
Genome map
AA seq 387 aa AA seqDB search
MTTESQIPTPAAGRPLVAITLGDPAGIGPEIVVKALADPEVYRVLRPLVIGDRGAVERAR
ALVPGAPAVRVVADPAHGAYTPGTLDLVDLANVPAGLALGRVQAEAGRAAYQFIERAVAW
ALAGQVDAVATAPIHKEALRAAGVPHIGHTEIFAELTGSPDPLTMFEVAGIRIFFLTRHV
SLRQALDLVRKERIVTTARAALGHLRSLGIAEPRLAVAALNPHAGDGGLLGREEIEEIAP
AVEALQQEGHRVAGPVPADSVFHLARQGAFDAVLSLYHDQGHIAAKSMDFEGTVSVTLGL
PFIRTSVDHGTAFDIAGTGKASAVSMKQAILAAGRLAGLRAGLTRAAGRPAAQQNGTAGR
HAGQPAAARHGAGSSRSEEPAPAERGA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagaatcccagatccccacgcccgccgccgggcggcccctggtggccatcacc
ctgggcgaccccgccggcattggaccggagatcgtggtcaaggcgctggcggaccccgag
gtctaccgggtgctgcggcccctggtcatcggcgaccgcggggcggtggagcgggcccgc
gccctggtgccgggcgccccggcggtgcgggtggtggcggacccggcccatggcgcctac
accccgggcaccctggacctggtcgacctggccaacgtgcccgccggcttggccctgggc
cgggtccaggccgaggcggggcgcgccgcctaccagttcatcgagcgggcggtggcctgg
gccctggccggccaggtggacgccgtggccacggcccccatccacaaggaggccctgcgg
gcggcgggcgtcccccacatcggtcacacggagatcttcgccgagctgacgggctctccc
gaccccctgaccatgttcgaggtggcggggatccgcatcttcttcctgacgcgccacgtc
tccctgcgccaggcgctggacctggtgcggaaggagcggatcgtgaccacggcacgggcc
gccctggggcacctgcggtccctgggcatcgccgagccgcggctggccgtggcggccctg
aacccccatgccggagacggcggcctgctgggccgggaggagatcgaggagatcgccccg
gccgtggaggcgctgcagcaggagggccaccgggtggccgggccggtgccggccgactcg
gtgttccacctggcgcggcagggcgccttcgacgcggtgctgtccctctaccacgaccag
ggccacatcgccgccaagagcatggacttcgagggcaccgtcagcgtgaccctgggcctg
ccgttcatccgcacgtcggtggaccacggcacggccttcgacatcgcgggcaccggcaag
gccagcgccgtcagcatgaagcaagccatcctcgccgccggccggctggccgggctgcgg
gccgggctaacccgtgcggccggacgaccggccgcgcagcagaacggtacggccgggcga
cacgccgggcagccggcggcggcgcgtcacggggccggttcgtcccgctcggaggaaccg
gcgcccgccgagaggggagcgtga

DBGET integrated database retrieval system