KEGG   Thermaerobacter marianensis: Tmar_2052Help
Entry
Tmar_2052         CDS       T01388                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tmr  Thermaerobacter marianensis
Pathway
tmr00240  Pyrimidine metabolism
tmr00250  Alanine, aspartate and glutamate metabolism
tmr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tmar_2052
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmar_2052
Enzymes [BR:tmr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tmar_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace
Motif
Other DBs
NCBI-ProteinID: ADU52133
UniProt: E6SJH8
Position
complement(2470978..2472345)
Genome map
AA seq 455 aa AA seqDB search
MLTGTTPQSVSPAATPPHALREAARATRPVPLPVPIPSPSPVHPQPKSHGGSRTLASADP
SGLPAAQPGVPPAPPGTPPGQLDISRPRSLTGIATLADPDLEDLLARAIRMMATLEARRD
AGLDPAPLQGRRVVTLFYENSTRTSQSFHVAAHLLGAAAFDLPVARSSVQKGESLRDTLR
TCAALGFDAVILRHPVTGAAAYAASVLDVPVINAGDGTGEHPTQALLDALTILRHKGRLA
GLKVAIVGDVRHSRVARSNALLLSRLGAEVWLCGPPGLLPSAPPRPGVTVTARLDEALAD
ADVVMALRIQRERLGGVLPDLAEYRRGWGIGPRQLAWARPGAILMHPGPVNRGIELDPEL
MEDPRCVIEEQVACGVAARMAVLEWALGGPATSAGAAEGAEPAPGAAGAVERAGTAHRVE
RAGPAGRVEPAAGGTPRAADAARPCARPAEEVSAR
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
gtgctgaccgggacgacgccccagtccgtgagccccgcggcgaccccgccgcacgccctg
cgcgaagcggcccgcgcaacgaggcccgttccccttcccgttccgatcccctcgccctcg
ccggttcatccccagccgaaaagccatggcgggtcgagaaccctggcgtcggccgacccg
tcgggcctcccggccgcgcagcccggcgtgccgcccgcgccgccggggaccccgccgggg
cagctcgacatctcgcggccccgctccctcaccggcatcgccaccctggccgacccggac
ctggaagaccttctcgccagagccatccggatgatggccacgctcgaggcccgcagggat
gcgggccttgaccccgcgcccctccagggccggcgcgtggtcaccctgttctacgagaac
agcacccggaccagccagtccttccacgtggcggcccacctgctgggggccgccgccttc
gacctgcccgtcgcccgcagcagcgtgcagaagggcgagagcctgcgggacacgctgcgc
acctgtgcggccctgggcttcgacgccgtgatcctgcgccacccggtcacgggcgcggcg
gcctatgcggcgtccgtgctggacgttcccgtcatcaacgccggcgacggtaccggcgag
caccccacccaggcccttctcgatgccctgaccatcctccggcacaaggggcggctggcg
gggctgaaggtggccatcgtgggcgacgtgcgccacagccgggtggcgcgctccaacgcg
ctgctcctcagccgcctgggggcggaggtgtggctctgcggcccaccgggcctcttgccc
tccgcgccgccccgcccgggcgtgacggtgacggcccggctcgacgaagccctggccgat
gccgacgtggtgatggccctgcgcattcagcgagagcggctgggcggggtgctgcccgac
ctggccgagtaccggcgcggctggggcatcggcccgcggcagctggcgtgggcccggccc
ggcgccatcctgatgcacccgggccccgtgaaccggggcatcgagctggaccccgagctc
atggaggacccgcgctgcgtcatcgaggagcaggtcgcctgcggcgtcgccgcgcggatg
gcggtgctggagtgggcgctgggcgggccggcgacctcggccggcgccgccgagggggcc
gaaccggctccgggtgccgccggggcggtcgagcgggcaggcaccgcccatcgggtcgaa
cgggccggtcccgccgggcgggtcgaaccggccgccggcggcacgccccgggccgccgac
gccgcccgtccctgcgcgcggccggcagaggaggtgagcgcgcggtga

DBGET integrated database retrieval system