KEGG   Tremella mesenterica: TREMEDRAFT_41207
Entry
TREMEDRAFT_41207  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tms  Tremella mesenterica
Pathway
tms00100  Steroid biosynthesis
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    TREMEDRAFT_41207
Enzymes [BR:tms01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     TREMEDRAFT_41207
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 PEMT ICMT
Other DBs
NCBI-GeneID: 18493222
NCBI-ProteinID: XP_007008261
JGI: Treme1_41207
UniProt: R7S9X6
Position
Unknown
AA seq 462 aa
MSQSDPVDGQITTTITATAHLTLPAHPTPMSYEELNPRSSAHEFFGPLGCLIVTFLTPIT
AYGLFFACNEVTGCPPSSSAAWRATWELIGDWPSLAGNLWDWNAMWVYLGWYIYCVACWA
VLPGQTVEGGLLRDGKRKVYKMNGTSTLLLTLGITVGIILQPGGPERFAWLYDHWVPLVS
ASLVMALAQAIWVYVWSFYSKELLAIGGNSGVFIYDFFLGRPLNPTFPGFPSFDIKTFNE
VRPGIILWVLLNVSCACEQYVRNGSVSDSMWLVLVFEGWYAADCLISEASILGQMDITTD
GFGFMLAFGDLTWVPFTYGLQARYLAFTPVHLGWARSAGIIALEVIGQYIFRVANNEKDQ
FRKGKNPKNLTFLETQRGTRLLTSGWWGRSRHPNYFGDWIMACAWCLPAGFGSPLPYFYV
VFFAILLIHRQMRDDEACKKKYGSDWDKYCELVPYRIVPYIY
NT seq 1389 nt   +upstreamnt  +downstreamnt
atgtcacagtcagacccagtcgatgggcaaatcaccaccacaatcacagcaacagctcat
ctcaccctccccgctcacccaactccgatgtcctatgaagagctcaaccctcgttcatca
gcgcacgaattcttcggtcctctaggatgtctcatagttacttttctcactccgatcacc
gcttatgggctcttcttcgcttgcaatgaagtgacaggatgtccaccatcctcatctgcg
gcgtggagagcgacatgggagttgatcggtgattggcccagtttagctggcaacctgtgg
gattggaatgccatgtgggtgtatctgggatggtacatttattgtgtggcttgctgggct
gtgcttcctggtcagacagtggaaggtggtttattgagagatggtaagaggaaagtatac
aagatgaacggaacatcaacacttcttcttactctaggaattacagtgggtatcatcctt
caacccggtggtccggaacgtttcgcttggctgtacgatcattgggtaccgctggtctcg
gcttctttggtcatggcgctcgctcaagctatatgggtgtatgtttggtctttttactct
aaagagctgttggctataggcggtaattccggagtgttcatctatgatttcttcctcggc
cgtcccctaaatcccacatttcccgggttcccctcgttcgacatcaaaacattcaacgaa
gtccgacctgggatcatcctttgggttttactcaacgtttcttgtgcctgcgagcagtac
gtacggaatggtagtgtgtcagattccatgtggctggtcttggttttcgaaggatggtac
gctgccgattgtttgatttcagaggcatccatcttgggtcagatggacatcacaaccgac
ggattcggtttcatgctggcttttggtgatcttacttgggttccattcacatacggactt
caagctcgatatctagctttcacccctgtacatcttggttgggcccgttccgctggtata
atcgctttggaagtgatcggacagtatatattcagagttgcgaataatgagaaggatcaa
tttaggaaaggcaaaaatcccaagaacctcacattcttggaaacacaacgaggcactcga
ctcctcacttccggttggtggggtcggtccagacatccaaattatttcggagattggatc
atggcctgcgcttggtgtctccccgctggtttcggttctccattaccatacttctacgtc
gttttctttgccatcctcctgatccatcgtcagatgagggatgatgaggcttgtaagaag
aaatatggatcagattgggataaatattgtgaattggttccgtatcgaatcgtcccttat
atctattga

DBGET integrated database retrieval system