KEGG   Tremella mesenterica: TREMEDRAFT_42503Help
Entry
TREMEDRAFT_42503  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
tms  Tremella mesenterica
Pathway
tms00430  Taurine and hypotaurine metabolism
tms00620  Pyruvate metabolism
tms00640  Propanoate metabolism
tms00680  Methane metabolism
tms01100  Metabolic pathways
tms01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    TREMEDRAFT_42503
   00640 Propanoate metabolism
    TREMEDRAFT_42503
  09102 Energy metabolism
   00680 Methane metabolism
    TREMEDRAFT_42503
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    TREMEDRAFT_42503
Enzymes [BR:tms01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     TREMEDRAFT_42503
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-GeneID: 18493368
NCBI-ProteinID: XP_007002516
JGI: Treme1_42503
Position
Unknown
AA seq 428 aa AA seqDB search
MYILAINCGSSSIKGKLYPIPSQPTQPLRDCASLSVSNIASHGERIKVKVNWTEGGKGLE
EEGEDGGNVEYSSLVPMLLGKLTTSGSVNKADIHYVVHRIVHGGTHEKGLVITKDHTEGL
DEMDKLSEFAPLHNHHAVLAVRSCLEALPDHTSFLAFDTLFHQTIPPETYTYALPPAHKP
IQMPIRKYGFHGLSYASIVRSLAGHLRKREEEINIVVAHLGSGASACCIKGGKSIDTSMG
LSPLEGLIGGTRSGTIDPTAIFHMFEDPGADGGLEGIQVTKAELVFNKQSGLLALAGTTN
FGLLLSRLSNPSDPEHGQAALAYSIYLDRLMGYVSQYLFKLLSTLPLSSIDGIVFSGGIG
ERASPLRKDVLSRFSWLGAEVDEGKNESKEIEEGVKEITKQGSGLKGWVVETDEEGWCAQ
LAREEFGF
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtatattttagctatcaactgcggatcatcatctatcaaaggtaaactctatcctata
ccttctcaacccactcaaccgttgagagattgtgcttctttaagcgtcagtaatatagct
tctcatggtgagagaatcaaggttaaagtgaattggacagaagggggaaaggggttggaa
gaggaaggtgaagatgggggtaatgtggaatactcttcactagtacctatgcttcttgga
aaactcactacttctggatcggtaaataaagcggatatacattacgtcgttcatcgtatt
gtacatggtggaactcatgagaaaggtttggtgatcactaaagatcatacggaggggtta
gatgaaatggataaattatctgaattcgctcctctccacaaccatcatgccgtcttagcc
gttcgatcatgtctggaagcattgccagatcataccagttttctagctttcgatactctg
tttcatcaaacaatacctccagagacatacacttacgcactgcctccagctcataaaccg
atacagatgcctattcgaaaatacggtttccacggattatcttatgcttctatagttcgt
tctctcgctggacacttgagaaaacgggaggaggagatcaatatcgtcgttgctcatttg
ggaagtggagcttccgcttgttgtatcaagggaggaaagtcgattgatactagtatggga
ctatcaccccttgaaggtctcatcgggggaactcggtcaggtactattgacccgactgcc
atttttcacatgtttgaagatcccggtgctgatggagggttggagggtatacaggtgaca
aaagccgaattggtgtttaacaaacaatccggtttgctagctttagcaggtaccaccaac
tttggtctcctcctctcccgtctttcaaacccctcagacccagaacacggacaagccgca
ctagcatattccatctatctcgatagactcatgggttacgtctcacaatacctcttcaaa
ttactttctacccttcctctctcttccatcgacgggatagtcttctccggtgggataggt
gaacgtgcttctcctttgagaaaagacgtcttatctcgtttctcttggcttggagcggag
gtggatgaggggaagaacgaaagtaaagagattgaagaaggggtgaaggagattacaaaa
cagggaagtggattgaagggttgggtggtggagactgatgaagagggttggtgtgcgcag
ttggcacgggaggaatttgggttttga

DBGET integrated database retrieval system