KEGG   Tremella mesenterica: TREMEDRAFT_43632Help
Entry
TREMEDRAFT_43632  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
tms  Tremella mesenterica
Brite
Enzymes [BR:tms01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     TREMEDRAFT_43632
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PAN_1 Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID: 18493524
NCBI-ProteinID: XP_007003988
JGI: Treme1_43632
Position
Unknown
AA seq 303 aa AA seqDB search
MSPPRISTPEEYRKLVDSVDTFLLDCDGVIYHGPVVVPGVKKVLEMLRKENKRLIFVTNN
ASKSRRQYKATFDKLGIPVSENEIFGSAYASAVFLRKVLNFAEDKKVYVIGQDGLEQELE
SVGIKHVGGTDPEDRVFMDPFDFASIQPDPSVGAVLCGFDGWLNYKKLCKAYTYLNSDPN
CHFLLTNQDKTFPTNGTTFPGSGSMSYPLVFALSGRREPTIIGKPNKHMMDAIIAEHQFD
PKRALMVGDNLLTDIEFGINSGIRTLLVMGGVSLPEQVFGDNPSHVVPTYVMESLGDLAV
LAE
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgtcccctccaaggatttccacaccggaagaataccgtaaactagtcgattcggtagat
acattcctcctagactgtgatggtgtaatctaccatggtcccgtagttgtcccaggcgtc
aaaaaggttctggaaatgttgagaaaggagaacaaacgtttgatattcgtcacgaataac
gccagtaaatccaggagacaatacaaggctacttttgataaattgggtataccagtcagt
gagaatgagatattcggatcggcatatgcttctgctgttttcttaaggaaagtgttgaat
tttgcagaggataaaaaggtttatgtgattgggcaggacgggttggaacaggaattagaa
agtgtaggtataaaacatgttggtgggacggaccccgaagatagagttttcatggaccca
ttcgactttgcttccatccaacctgatcctagtgtaggtgctgtcttatgcggatttgat
ggctggttgaattataaaaagctatgtaaagcttatacatacctcaactccgaccctaac
tgtcatttcctcctgaccaaccaagataagactttccccaccaacgggaccacttttcct
ggttccgggtcaatgtcatatcctctcgtcttcgccttatccgggagaagagaacctaca
atcatcggtaaacctaacaaacacatgatggacgctatcatcgctgaacatcaattcgat
cccaaacgcgctcttatggtgggcgataatctcctcaccgacattgagttcgggataaac
tccggtatacgtactttactcgtcatgggtggtgtatcccttcccgagcaggtgtttggg
gataatcccagtcatgtggttcctacttatgtaatggagagtttaggtgatttagctgtg
ttggcggaataa

DBGET integrated database retrieval system