KEGG   Tremella mesenterica: TREMEDRAFT_70540Help
Entry
TREMEDRAFT_70540  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
tms  Tremella mesenterica
Pathway
tms00350  Tyrosine metabolism
tms00360  Phenylalanine metabolism
tms00380  Tryptophan metabolism
tms01100  Metabolic pathways
tms01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tms00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    TREMEDRAFT_70540
   00360 Phenylalanine metabolism
    TREMEDRAFT_70540
   00380 Tryptophan metabolism
    TREMEDRAFT_70540
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    TREMEDRAFT_70540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tms04147]
    TREMEDRAFT_70540
Enzymes [BR:tms01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     TREMEDRAFT_70540
    4.1.1.105  L-tryptophan decarboxylase
     TREMEDRAFT_70540
Exosome [BR:tms04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TREMEDRAFT_70540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_1_2 Endothelin
Motif
Other DBs
NCBI-GeneID: 18498329
NCBI-ProteinID: XP_007008636
JGI: Treme1_70540
UniProt: R7SB87
Position
Unknown
AA seq 534 aa AA seqDB search
MTLASLVGLDRSCPCYAAVDAICDYYTHLDRRPVKAEVEPGYLLAQLPGEAPQTGQPFPS
IARDFQRLILPGITHWQHPSFFAYFPAISTFESMLGDLYAASVSNPGFNWVCSPACTELE
QVVMDWMAKILGLHPSFHIGSGKGGGIISVRWSNISPVGDVTRLKSREPLQKQLSQLQWR
PGKGLYGISATVLTSPGMDAVPGSPISNEVREKWSQKLVMYGSTQTHSIAAKAARLLGLR
FRAVHVTAADGYALRGDALREAIEADVATDLVPFFVVATIGTTSTGAVDHIADIGQVLNS
YPTAFLHVDAAWAGMAYALPEYRAKLRLDEVNTYAHSFCANAHKWGLVGFDYSLFYIRDR
KDLTEALDVTPAFLRSKEGDSGIVIDYRNWQLALGRRFRNVKLWFVLRSYGVDGLQKHLR
SGIHHCRKLADRIRSSKDFKLVAEPSLSLLVFRLQPQGYEGGEDDDLNRLNKTLHERLMA
RSDVFLTRTVIKTEEGEMTCIRFAMGGLKTTLECVNATWDVVEQEGAAVFAKDE
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgacacttgcctcgttggtgggtttggatcgatcttgcccttgttatgccgccgtcgat
gccatatgcgactactatacccacttggaccgacgaccggtcaaggccgaggtggaaccg
gggtatcttcttgcccaactacctggtgaagcccctcaaactggccaacctttcccttcc
atcgctcgtgactttcagcgtctcatcttaccggggatcacccattggcaacaccccagc
ttcttcgcctactttcccgctatatccaccttcgagagcatgctaggagatctctatgcc
gcaagtgttagcaatccaggtttcaactgggtatgttccccagcgtgcacagaactcgaa
caagttgtcatggactggatggccaagatattaggtctgcatccttcatttcatataggg
agtgggaagggagggggaataatctcggtacgttggtccaacatatctccagttggtgat
gtcactcggctgaagagtagggaaccgcttcagaagcagctttcacagctgcaatggcgg
ccagggaaagggctctacggtatctcagcgacggtcttgaccagtccaggaatggacgct
gtcccgggatctccaatttccaacgaggtccgagagaagtggtctcaaaagcttgtgatg
tatggcagtactcaaacccacagcattgctgccaaggccgctcgactactgggtcttcga
ttcagagcggtccatgtgaccgccgccgacggctacgctcttcgtggagatgctcttcga
gaagcgatcgaggccgacgtagccaccgatctggtaccgttctttgtcgtcgcgacaatc
ggaacaacctctaccggtgcagtcgaccatatcgcagacattggtcaagtcttgaactcc
taccccaccgcgtttctccatgttgatgctgcttgggcagggatggcttatgcccttcca
gagtatcgagcgaagcttcgtctcgacgaggtcaacacatatgctcattcattctgcgcc
aacgctcacaaatggggtctcgtggggtttgattattcgctattttacatcagggacagg
aaggatctgacagaggctctggatgtcacaccagcgttcttgcggagtaaagaaggtgat
tcaggaattgtcatcgactatcgcaactggcaattggctctgggaagacggttcaggaat
gtcaaactgtggttcgtcctccgaagttacggcgttgatgggttgcaaaaacatctacga
tcaggaatccatcactgccgaaaattggcagatcggatcaggtcgtcaaaggattttaaa
ctcgtcgccgaaccaagtctgagtctactcgtcttccgtcttcagccacagggatacgag
ggaggcgaggacgatgacctgaataggttgaacaagaccctgcatgagcgtctgatggcg
aggagtgacgtgttcttgactcggacggtgatcaagactgaggaaggggagatgacctgc
atccggtttgccatgggtggactgaagacgacattggagtgtgtgaacgcgacttgggac
gttgtggagcaagagggagctgcggtgtttgcgaaggatgagtag

DBGET integrated database retrieval system