KEGG   Tremella mesenterica: TREMEDRAFT_71807Help
Entry
TREMEDRAFT_71807  CDS       T03139                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
tms  Tremella mesenterica
Pathway
tms03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tms00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    TREMEDRAFT_71807
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tms03041]
    TREMEDRAFT_71807
Enzymes [BR:tms01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     TREMEDRAFT_71807
Spliceosome [BR:tms03041]
 Complex C
  Other components
   Step II factors
    TREMEDRAFT_71807
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OB_NTP_bind HA2 Helicase_C S1 DEAD AAA_22 AAA_30 T2SSE AAA_19 PhoH DUF2075 AAA_14 ATPase
Motif
Other DBs
NCBI-GeneID: 18498612
NCBI-ProteinID: XP_007005252
JGI: Treme1_71807
Position
Unknown
AA seq 1184 aa AA seqDB search
MSTDKELYKLELLSLVTRVSQELFNHTKLQDKSLAEFVIALHEQSKDAVAFQQKLAEIGA
DFPEWFIKNLDRLIVTMHPKYKRKATKIKASRDKNGNGSGDVKDIVARKFPGLALPDQEW
TAADKYIQNRAEREGDGDSLPKSLSVDDAMIELASVSARRNRPSAEDFIDGEPPSKRSRG
TMDQTGRADYSNGDSKTADRYGSMSAAYPGHRGSHRPSQDEKPVLYKIYSGNVNGVRDFG
AFVLLDGVQGRVEGLVHVSNIIGARVQSATELLHRNQRVKVKVMSVTGNKYSLSMKDVDQ
NTGADLSPHLYVRTDEEARAEERRAAARSASGSNTTPLVSVDERRGKGAKRLSSPERFEI
KQLIASGVIDASDYPDLDDDLHAASNNVEIEEDIDIEVNEIEPAFLAGQTKITLELSPVK
IIKAPDGSLNRAALAGTSLAKERRDLKRLEANESAESESRDLSQPWLDPMANPNERQFAS
DIKGNLVGQKTAQMPAWKAANKVTSYGRITSMSIQEQRRSLPIYKLREQLVQAIRDNQIL
VVVGDTGSGKTTQMAQYLAEEGFLEKGKLGCTQPRKVAAVSVAKRVAEEVGCRLGAEVGY
TIRFEDLTSPETKIKYMTDGMLLRELLVDPDCSKYSVIMLDEAHERTIATDVLFGLMKKA
CKRRPDLKLICTSATLDAAKFATYFWGCPIFTIPGRTFPVEVLYTKDPEPDYLEAALITI
LQIHLMEPAGDILVFLTGQEEIDTSCEILYERVKALGPQVPELIILPVYAALPSEMQSRI
FDPPPPGARKVVIATNIAETSITIDGIYYVIDPGFAKQNAYDPKLGMDSLIVTPISQAQA
RQRAGRAGRTGPGKCYRLYTEVAYRNEMLPNPIPEIQRTNLASTILTLKAMGVNDLISFD
FMDPPPAPTMLTALEQLYALGALDDEGLLTRIGRKMADFPLDPPLSKMLIKSVDYGCSEE
ALTIVAMLQAGGQVYYRPKDKQAQADAKKAKFHQPEGDLLTLLAVYNGWKGSKFSNPWCF
ENFIHTRAMKTAQDVRKQLIGIMDRYKHDLVSCGSNYNRVRMAICSGFFRNAAKKDPTEG
YKTLVEGTPVSIHPSSALFQRPPEWCVYYELVLTAKEYMHQVTAIEPKWLSEVAPTFFRV
ADQNKISKRKQSEKIEPLFDRFAADKDDWRLSKQKRPTRSSQTF
NT seq 3555 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccgacaaggagctgtacaagctagagctcctgtcgctcgtcaccagagtgtcc
caggagctcttcaatcatacaaagctgcaggacaagagtctggcggaattcgtcatagct
ttgcatgagcaaagcaaagatgccgtcgctttccagcaaaagcttgcagagataggagcc
gactttccggaatggttcatcaagaacctcgatcgtctcatcgtcaccatgcatccgaaa
tacaaacgcaaggcaacaaagatcaaagcttctcgtgataagaacggcaatggcagcggc
gacgtgaaggacatcgtcgctcgaaagtttcctggtctcgcccttccggatcaggaatgg
accgcggccgacaagtatattcaaaatagggcggagagagaaggtgatggcgactcatta
cccaagtctctatctgtcgacgacgcaatgatcgaactcgcatccgtgtcggcgaggcgg
aatagaccatccgccgaggatttcattgacggagaaccgccctcgaaaaggtcaagaggc
acgatggatcagactgggagggcggattacagcaatggagactcaaagactgccgatagg
tacggaagcatgtccgccgcctacccgggtcatcgaggctcacatcgtcctagccaggac
gagaagcctgtgctctacaagatttatagcggtaatgtgaatggggtgcgtgattttgga
gctttcgtgctccttgatggagttcagggtcgggtagaaggcctcgttcacgtttcaaac
atcattggtgccagggtgcaatccgccacggagctgctgcatcgaaatcaacgtgtgaaa
gtaaaagtcatgagtgtcactggcaataaatacagtttgagtatgaaagatgtagaccag
aacaccggagcggacctttcacctcacctatacgtgcgcacagatgaagaagcgagagca
gaagagagacgggcagcggctcgttcagcgtctggaagtaatacaacaccgctagtatca
gttgacgaacggaggggaaagggcgccaagagattatcgagcccggagagattcgaaatc
aagcaattgatagccagcggcgttatcgatgcctcagattatccagacttagacgatgac
ttacatgcggcatctaacaatgtggagattgaggaggacatcgatatcgaggtcaatgaa
atagagccagctttcctcgccggtcaaacaaagattactctcgagctgtctcctgtcaaa
atcatcaaggctcctgatggatctctcaaccgtgctgctctagcaggtacatccttagcg
aaagaacgacgtgatcttaaacgcttggaagccaacgaatccgccgagtctgaatcccga
gatctgtctcagccgtggctggacccaatggccaatcctaacgagcgtcagttcgcttct
gacatcaagggtaatttggtcgggcagaagactgcgcaaatgccagcctggaaagcggcg
aacaaagtgacatcgtacggccgtataacttcgatgagcattcaggagcagcggcgtagt
ctgccaatatacaaactgcgcgaacaactggtccaagccattcgtgataatcaaattctg
gtggttgtcggtgacaccgggtcggggaaaaccactcagatggcgcaatacttagctgag
gaaggctttctggagaaaggaaagctcggatgtacacagcctcgaaaagttgccgcggtc
tccgtcgccaaacgtgtcgcggaagaggttggctgtcgattaggtgcagaagttggatac
accatacgattcgaggatctaacaagtcccgaaaccaagataaagtatatgacggacggt
atgcttctgcgtgaactcctggtcgacccggactgctccaagtattctgtcattatgttg
gacgaagcgcacgaaagaacgatagctactgatgtcctcttcggactgatgaagaaggct
tgcaaacgacgcccagacctgaagcttatatgcacttccgctacactggacgcagccaaa
ttcgccacttatttctgggggtgtccaatctttacgattccgggacgaacttttcctgtg
gaggtcctctacacaaaggatccggagcctgattatctggaagccgcgctcatcactatc
ctgcagattcacctcatggagcctgccggcgacattcttgtctttttgactggtcaagag
gagatcgatacttcttgcgagattctttacgaacgcgtcaaagccctggggcctcaagtt
cccgaactcatcatccttcccgtgtacgccgctcttccatcagaaatgcagtcccgaata
tttgaccctccgccaccaggcgcacgtaaagtcgtcattgccacaaatatagccgagacc
agcatcactatcgatggcatctactatgtcatcgatccgggatttgccaaacagaacgct
tacgacccgaaactcggtatggactcgttgatcgtcactcctatctcccaagctcaagct
cgtcaaagagccgggcgtgctggtcgtactggccccgggaagtgttatcgtctttacacc
gaagtagcctatcggaacgaaatgctgccaaatcctatccccgaaattcagcgtaccaac
ttggcgtcgactatcctgacgctcaaagctatgggagtcaatgacttgatcagttttgac
ttcatggatcctcccccagcccctaccatgttgacagcgttggagcagctgtacgctttg
ggagcgcttgacgacgagggcctccttactcgcatcggtcggaagatggccgatttccct
ctcgatccaccattatcgaagatgctcatcaaatctgtcgattatggttgctcagaggaa
gctctgactattgtggccatgctccaagctggaggtcaagtatattatagacctaaggac
aagcaagctcaggcggacgccaagaaggccaaatttcatcagcctgagggagatcttctt
acccttttggctgtctacaatggatggaagggctctaaatttagtaacccgtggtgcttc
gagaactttatccacacaagagctatgaagactgcacaggacgtgagaaaacaactgatc
gggatcatggatcgttacaagcacgacttagtttcgtgcggatccaattacaatcgggta
cgaatggcaatatgctctgggtttttccgcaacgccgccaaaaaagatcccacggaaggg
tacaaaacactagtagaaggcacgcccgttagcatacatccctctagcgccctctttcaa
cggccgccagaatggtgcgtgtactacgagctggttctcaccgcgaaggaatacatgcac
caagtcactgcaatcgaacctaaatggttatccgaggtcgctcctaccttcttccgtgtg
gcagatcagaataagatcagtaaacgaaagcaatctgaaaagattgaacccttgtttgac
cgcttcgccgctgacaaggatgactggcgactcagtaaacaaaaacgaccgacacgatct
tcacagacgttttag

DBGET integrated database retrieval system