KEGG   Thermoanaerobacter mathranii: Tmath_0496Help
Entry
Tmath_0496        CDS       T01250                                 

Definition
(GenBank) Cellulase
Organism
tmt  Thermoanaerobacter mathranii
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M42 Peptidase_M20 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: ADH60255
UniProt: D7ASN1
Position
518985..520007
Genome map
AA seq 340 aa AA seqDB search
MLLKELTDLMGASGDEKEVREKIKEIVKPYVDELYVDKMGNLIACKKGKKEKPKVMLAAH
MDEVALMVKSINEDGTLSFSPVGGVDNRILVSKTVKVGEKRVNGVIGAKPIHLQKREEQQ
KPLDFDALYIDIGATSKEEALKHVSVGDYVYFDANFELLGNGYVKSKALDDRIGCNVLIE
ILKRDYEYPVCAAFTVQEEVGLRGAGVAAYNIEPDFAIVVEGTVAADVSDSEPHLVSTEL
GKGPAISLMDRTTLYDKKIINKIVKIAEENGVPYQFRRIASGGNDAGKIHLTKGGIKAIA
VSVPCRYIHSFNSVAFLEDFNNTVKLVDLIIKNIAKEALI
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgttattaaaagagctgacagatttgatgggtgcttcaggagatgaaaaagaagtaagg
gagaaaattaaagagattgtaaaaccttatgttgatgaactttatgtagacaaaatgggc
aatctgatagcctgcaaaaaagggaaaaaggaaaaacctaaagtgatgctggctgcccac
atggatgaagtagctttaatggtgaagtctataaacgaagacgggactttgagcttttca
cctgttgggggagtagacaaccgaatacttgtatctaaaactgtaaaagtgggcgaaaag
agggtaaatggcgtaataggtgctaagcctatacatcttcaaaaaagggaagagcagcag
aagcctcttgattttgatgcattgtacatagacataggggctacttcaaaggaagaggca
ttaaagcacgtttctgtaggggattatgtgtattttgatgccaactttgaactactggga
aatggatatgtaaaatcaaaggctttagatgacagaataggctgcaatgttttgatagag
atcttgaaaagggattatgaatatcctgtttgtgcagcttttactgtgcaggaagaggtt
ggtttaagaggagctggcgttgcagcctacaatatagagccggattttgctatagttgtg
gaaggcacagtggctgcggatgtttctgactcggaacctcatttggtttctaccgagtta
gggaaggggccggcaatttcattaatggacagaacgaccctttatgacaaaaagataatt
aacaagattgtaaaaatagcagaagaaaatggtgtgccttatcagtttagaaggatagcc
agtggtggcaatgatgcaggtaaaattcacctaacgaagggtggcataaaagcaattgct
gtatctgtcccctgtaggtatattcactcttttaattctgtagcctttttagaggatttt
aacaacacagtcaaattagttgatttgataataaagaatattgcgaaggaggctttgata
tga

DBGET integrated database retrieval system