KEGG   Thermoanaerobacter mathranii: Tmath_0766Help
Entry
Tmath_0766        CDS       T01250                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00040  Pentose and glucuronate interconversions
tmt00052  Galactose metabolism
tmt00500  Starch and sucrose metabolism
tmt00520  Amino sugar and nucleotide sugar metabolism
tmt01100  Metabolic pathways
tmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Tmath_0766
   00052 Galactose metabolism
    Tmath_0766
   00500 Starch and sucrose metabolism
    Tmath_0766
   00520 Amino sugar and nucleotide sugar metabolism
    Tmath_0766
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Tmath_0766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Glycos_transf_2 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ADH60504
UniProt: D7ATZ7
Position
806803..807717
Genome map
AA seq 304 aa AA seqDB search
MKIRKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIVEEAIQSGIEDILIITGRNK
RAIEDHFDKSVELELELKKKKKENLLHLVEDITNMVDIHYIRQKEPKGLGHAIYCARAFV
GNEPFAVLLGDDIVDAEVPVLKQMIEQYERYNCTIIGVQQVPYEDVDKYGIVDSTPIEDR
LYKVNNLVEKPKKEETPSNIAILGRYIITPRIFEILENTSPGAGGEIQLTDALKTLLNYE
AIYAYNFIGKRYDVGDKLGYLMATVEYALKREDLREPFKRYLLEVARNLDPVGEEAASTI
TREV
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaataaggaaggcgataattccggctgcaggccttggtaccaggtttttacctgct
accaaagcccagcctaaagaaatgcttccaattgtggacaaacccactattcagtacata
gttgaagaagcaatacagtctggaattgaagatatacttataataactgggaggaataaa
agagcgatagaagaccattttgataaatcagtagagttggagctggagttaaaaaagaaa
aagaaggaaaaccttttgcatcttgtggaagacattactaatatggtagatattcattac
attaggcaaaaagaaccaaaaggtttaggtcatgccatatactgtgcgagagcttttgtg
ggaaatgagccctttgctgttcttttgggggatgacatagtagatgctgaagttcctgtt
ttgaagcagatgattgaacaatacgaaaggtacaactgcactattattggagtgcaacaa
gtgccgtatgaggatgtagataaatacggtattgttgattctacacctattgaggacaga
ttgtacaaagtgaataatctcgtagaaaagcctaaaaaagaagaaacaccatcaaatata
gctattctgggaagatatataataacgccaagaatatttgaaatattggaaaacacgtca
ccaggagcaggaggtgagatacagcttacggatgctttaaaaactcttttaaattatgaa
gcaatttacgcctataattttattggcaaaagatatgatgtgggagataaattaggttac
cttatggcaactgttgagtatgctctaaaaagagaagacttaagagaaccttttaagaga
tatttattggaagttgcaagaaatttagatccggtgggagaagaagctgcatcaacaatt
acacgagaagtttaa

DBGET integrated database retrieval system