KEGG   Thermoanaerobacter mathranii: Tmath_0910Help
Entry
Tmath_0910        CDS       T01250                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00860  Porphyrin and chlorophyll metabolism
tmt00970  Aminoacyl-tRNA biosynthesis
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01120  Microbial metabolism in diverse environments
Module
tmt_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tmath_0910
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Tmath_0910
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tmt01007]
    Tmath_0910
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tmt03016]
    Tmath_0910
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:tmt02048]
    Tmath_0910
Enzymes [BR:tmt01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Tmath_0910
Amino acid related enzymes [BR:tmt01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Tmath_0910
Transfer RNA biogenesis [BR:tmt03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Tmath_0910
 Prokaryotic Type
   Other AARSs
    Tmath_0910
Prokaryotic defense system [BR:tmt02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Tmath_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ADH60645
UniProt: D7AN79
Position
944825..946267
Genome map
AA seq 480 aa AA seqDB search
MGEVRVRFAPSPTGSLHIGGARTALFNWLFARHYGGKFILRVDDTDLQRSTKESMKGILD
GLKWLGIDWDEGPIYQSQRLDEYRKFANKLLDEGKAYYCFCTKEELEEMRRRAENEGRPF
MYTGKCRNLTREQIEEYLKKGKRPVIRLKVPSEGKTIVHDIIRGDVEFDNSTIDDFIIMK
SDNMPTYNFATVVDDYQMGITHVIRAEEHLSNTPKQILIYEALGLETPQFAHVSMVLAPD
RSKLSKRHGATSVQEFEEQGYLPEAIVNYITLLGWMPKDGEEIFDVSKSIKEFTLERVSK
NPAVYDVQKLTWINGHYIRNYDLDKLTEAVIPFLKDKNLIREEFDYDYIKKIVSIVRERE
KTLVDIADAMSYYFTEVNEYEEKGVKKYFTKEKVAEILKKAAETLKEVEPFDKFTTEKVY
RKLVEELQISSGELFHPTRLAISGRTFGPGLFDIMELLGKERTIQRIEKALDFIEKMKNP
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgggtgaagtaagagtaagatttgctccaagtcctacagggagtttacatataggcggt
gccaggacagccctttttaattggctttttgcaaggcactatggaggaaaatttatttta
agggtggatgatactgacctacaaaggtctacaaaagaatctatgaaaggaatacttgat
ggacttaagtggttaggtattgattgggatgaaggacctatttaccaatcccaaaggtta
gatgaatatagaaaattcgcaaataaattattagatgagggcaaggcttactactgtttt
tgtacaaaagaagagctagaggaaatgagaagacgggcagaaaatgaaggtaggcccttt
atgtatacaggaaaatgtaggaatttgaccagagaacaaattgaagagtatttaaaaaaa
ggcaaaaggcccgttataagattaaaggtgcctagtgaaggaaaaacaattgtgcacgat
ataataagaggagacgtagaatttgataattctactattgatgactttataattatgaaa
tcagacaatatgcctacttataactttgccactgtggtagatgattaccaaatggggata
actcatgttatacgggcagaagaacatttatcaaatactccaaagcaaatactaatttat
gaggctttaggtttagaaactcctcaatttgcccatgtatctatggttttagctcctgat
aggagtaaacttagtaagagacatggagctacttccgtgcaagagtttgaagagcaagga
tatctccctgaagcgattgtaaattatataaccttactaggatggatgccaaaggacggg
gaggaaatttttgatgtttcaaaaagcataaaagaatttactttagaaagggtatcaaaa
aatccagctgtttacgatgtacaaaagctgacttggataaacggccattacataaggaat
tacgatttagataagttaactgaagcagttattccatttttgaaagataaaaacttaatt
agggaagagttcgattatgactacatcaaaaaaatagtaagtatagtaagagaaagggaa
aaaactctagtggatatagctgatgccatgagttattattttacagaagttaacgagtat
gaagaaaaaggagtcaaaaagtattttactaaagagaaagtcgcagaaattttgaaaaag
gcagcagagactttaaaagaagtagaaccttttgataaatttacgactgagaaagtttat
cgcaaacttgttgaggaattacaaatatccagcggtgaactttttcatcctactagatta
gctatttcagggagaacttttgggccaggactatttgacataatggaacttttgggaaaa
gaaagaactatccagagaattgaaaaagctttagattttattgaaaagatgaagaaccca
taa

DBGET integrated database retrieval system