KEGG   Thermoanaerobacter mathranii: Tmath_1186Help
Entry
Tmath_1186        CDS       T01250                                 

Definition
(GenBank) Conserved carboxylase region
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00620  Pyruvate metabolism
tmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Tmath_1186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tmt02000]
    Tmath_1186
Enzymes [BR:tmt01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Tmath_1186
Transporters [BR:tmt02000]
 Other transporters
  Primary active transporters [TC:3]
   Tmath_1186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like TGT
Motif
Other DBs
NCBI-ProteinID: ADH60903
UniProt: D7ANY7
Position
1195356..1196753
Genome map
AA seq 465 aa AA seqDB search
MSNKIKITETVLRDAHQSLLATRMSTEEMLPIAEKLDAVGYYSIEAWGGATFDACMRFLN
EDPWERLRKLKKKIKNTPLQMLLRGQNLLGYRHYPDDIVEKFVEKAVTNGIDIIRIFDAL
NDVRNLEVAIKATKKAGAHAQGTLVYTISPVHNIDHYIKVAKELTELGVDSICIKDMSGI
LTPYVAYELVKSLKDAVNIPIQLHSHYTSGMAAMTYLKAIEAGVDIIDTAISPLALGTSQ
PATETMVAILKGTQYDTGLDMELLSEIASYFKEVKQNHSKEIDLSMVMGVDTDVLIYQVP
GGMLSNLISQLKQQNALDKYPEVLKEIPKVREELGYPPLVTPMSQMVGTQAVLNVITGER
YKMVPKEVKDYVKGLYGRPPAPISEEIKKKIIGDEEVIDIRPADLLKPQFEAIKEEIKEY
YEQEEDVLSYALFPQVAKKFFEYRRAKKYQIDETLLNKEYMTYPV
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagcaataaaattaaaatcacagaaactgtattaagagatgctcatcagtcactattg
gctactcgaatgtcgacggaagaaatgcttccaattgcagagaaattggatgcagtagga
tattattctattgaagcatggggaggcgctacttttgatgcttgtatgagattcctcaat
gaggacccatgggaaagattaagaaaattaaaaaagaagataaaaaatacacctcttcaa
atgcttttgagaggacaaaatctactaggatataggcattatccggatgatattgtagaa
aaatttgttgagaaggctgtcacaaatggaatagatataataagaatttttgatgcctta
aatgatgtacgaaatcttgaagttgcaataaaagctactaaaaaagcgggagcccacgct
caaggtacccttgtttatactataagtcctgttcacaacattgaccattatattaaagta
gcaaaagagctgacagaattaggagtggattccatatgcataaaggatatgtcaggaata
ttaactccttatgttgcttatgagttagtaaaaagccttaaagatgcagtaaatattcct
atacagttgcacagccattatacgagtggaatggcggctatgacttatcttaaagcaata
gaggctggagtagatataatagacactgctatttcacctttggcattaggaacttctcaa
cctgctacagaaacaatggtagctattttaaaaggcactcaatatgacactggtttggat
atggagttattatcagaaattgcttcatactttaaagaagtaaaacaaaatcacagtaaa
gaaatagatttatctatggttatgggcgtagatacagatgtattaatttatcaagttcca
ggaggaatgctatcaaatttaatttcccaattaaaacaacaaaatgctttagataagtac
ccagaggttttaaaagaaattcctaaagttagagaagaattaggatacccacctcttgtt
acccctatgagtcagatggtagggactcaagctgtcttgaatgtaataactggagaaagg
tataaaatggtaccaaaagaagtaaaagattatgtgaaaggactgtatggtagaccacca
gcgccaatttcagaagaaataaagaaaaaaataataggagatgaagaggtaatagatatt
agaccagcagaccttttaaaaccgcaatttgaagcgattaaagaagaaattaaagagtat
tatgaacaagaagaagatgttttatcttatgctcttttcccacaagtagcaaagaagttt
tttgaatatagaagggcaaaaaaataccaaatagatgaaactcttcttaataaagaatat
atgacatatccagtctga

DBGET integrated database retrieval system