KEGG   Thermoanaerobacter mathranii: Tmath_1387Help
Entry
Tmath_1387        CDS       T01250                                 

Definition
(GenBank) aspartate carbamoyltransferase
  KO
K00609  aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00240  Pyrimidine metabolism
tmt00250  Alanine, aspartate and glutamate metabolism
tmt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tmath_1387
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Tmath_1387
Enzymes [BR:tmt01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Tmath_1387
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: OTCace_N OTCace 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ADH61101
UniProt: D7API5
Position
complement(1383545..1384459)
Genome map
AA seq 304 aa AA seqDB search
MKRKDLLGIKDLSKEEILEVLETAKEMKKILNGEKYSQILKGKTVVTIFFEPSTRTRLSF
EMATKYLGAHYGNIEVATSSVAKGESLIDTIRTVEMMKADVIITRHNMSGAPHLMAKYTD
ASIINAGDGINEHPTQALLDMMTIREKKESFEGLKVAIIGDIMHSRVARSNIWGLKKMGA
EVRAAGPSTLIPPAIEKMGVKAYYNVEEAIKDVDVVMGLRIQLERQKSGLFPSIDEYREY
FGINKERMKLAKPDAILMHPGPINRNVELTSEAANDKYSVIEEQVTNGVAVRMALLKILC
ERRN
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgaagagaaaagacctgttaggcattaaggatttatcgaaagaagaaatactggaagtt
ttagaaaccgcaaaggagatgaaaaaaattctaaatggagaaaaatattcgcagatacta
aagggaaagacagttgtaacgatttttttcgaacctagcacgaggacaagactatctttt
gagatggcaacaaagtatttaggcgctcattacggcaatatagaagtggcaaccagcagt
gttgctaaaggggagtctttaatagacaccataaggactgttgagatgatgaaggcggat
gtgataataacaagacacaacatgagtggagcgccgcatcttatggcaaaatacactgat
gcctctatcataaacgcaggagatggtataaatgaacatcctactcaagccttgttggac
atgatgacaatcagagaaaagaaagaaagctttgaaggattgaaagtagcaataatagga
gatattatgcacagcagagttgcacggtcaaacatatggggacttaaaaagatgggggcg
gaggtgagagctgcaggcccttcaaccttaatacctcctgcaatagaaaaaatgggagtt
aaagcttactacaatgtagaggaagctataaaagatgtggatgtagtgatgggactaaga
attcaattggaaaggcaaaaaagtggcctattcccgtcaattgacgaatacagagagtat
tttgggataaataaagagagaatgaaacttgcaaaacctgatgcgatattgatgcatcca
gggcctataaacagaaatgttgaacttacgtcagaagcagcaaatgacaagtattctgtc
atagaagaacaggtgacaaacggtgttgctgtcaggatggcacttttaaaaatactttgt
gaaaggagaaattaa

DBGET integrated database retrieval system