KEGG   Thermoanaerobacter mathranii: Tmath_1420Help
Entry
Tmath_1420        CDS       T01250                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01130  Biosynthesis of antibiotics
tmt01230  Biosynthesis of amino acids
Module
tmt_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tmath_1420
Enzymes [BR:tmt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tmath_1420
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS His_biosynth QRPTase_C FMN_dh
Motif
Other DBs
NCBI-ProteinID: ADH61132
UniProt: D7APL6
Position
complement(1415867..1416649)
Genome map
AA seq 260 aa AA seqDB search
MVLDEIVRHKKKEVEEKKRIKPVEELINEIKGGYSGNFKKALQKEGISIIGEIKKASPSK
GIIKDEFDPVKIAKVYEKVDIDAISVLTEKEFFKGDDNYIREVKKVTSKPILRKDFIVDE
YQIYESKILGADAVLLIVSVLGDKLRDFYNLSKSVGLDALAEVHDRQQLAIALEAECDII
GINNRDLKTFNVDINTTKSLIKYIPQSTIIVSESGIKIPEDVRYLASLGVDAVLIGETFM
KIIDDIDKITDFVREAKGGG
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atggtattagatgagattgtgagacataaaaaaaaggaggtggaagagaaaaaaagaata
aagccagtggaggaactaattaacgaaattaaaggaggctattctggcaatttcaagaaa
gcacttcaaaaagagggtatatcaattattggagagataaaaaaagcctctccctctaaa
ggaattataaaagatgagtttgatccagtaaaaattgcaaaagtgtatgagaaagttgat
attgacgctatttccgttttgacagagaaggaattttttaaaggggatgacaactatatc
agggaagtaaaaaaagtcacttcaaaacctattttgagaaaagattttatcgtggatgaa
taccaaatatatgaatcaaaaattttaggagccgacgcagtacttctcattgtttccgta
ttaggtgacaaattaagagatttttataatttatctaaaagtgtaggtttagatgcgctt
gccgaagttcacgatagacagcagcttgcaatagcattagaagctgaatgtgacataata
ggtataaataacagagacctcaaaacttttaatgtagatataaacacaacaaaaagtttg
attaaatatatacctcaaagtacaataattgtttccgaaagtggaataaaaatacctgaa
gatgtaaggtatttagcttcattgggagtagatgccgtattaattggcgagacttttatg
aaaattatagatgatattgacaaaatcactgattttgtgagggaggcaaaaggaggagga
taa

DBGET integrated database retrieval system