KEGG   Thermoanaerobacter mathranii: Tmath_2041Help
Entry
Tmath_2041        CDS       T01250                                 

Definition
(GenBank) NAD-dependent epimerase/dehydratase
  KO
K00091  dihydroflavonol-4-reductase [EC:1.1.1.219]
Organism
tmt  Thermoanaerobacter mathranii
Brite
Enzymes [BR:tmt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.219  dihydroflavonol 4-reductase
     Tmath_2041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3Beta_HSD Epimerase GDP_Man_Dehyd NAD_binding_4 NAD_binding_10 Polysacc_synt_2 NmrA RmlD_sub_bind KR adh_short
Motif
Other DBs
NCBI-ProteinID: ADH61718
UniProt: D7ASF3
Position
complement(2051794..2052768)
Genome map
AA seq 324 aa AA seqDB search
MIIVTGGTGHIGNVLVKRLLGRGYKVKIIVPPGENLTSIFGLDVEIEFTDVRNKTYLVDC
FKGAEVVFHLASLISIFTKDKRVYDVNVCGTENVIEACIKNNIKKLVYVSSVHALKEEPK
GKVIKENKDFNPAYVKGDYAKSKAIATAKVLESQKLGIEPIVVHPSGVIGPYDYKISFMN
QVIINYLMGKYKFLIEGAYNFVDVRDVAEGIILAWEKGKAGENYILSGEVITIEKLFSYL
EEITGIKKPPIINRYIGEFFSYFADIYYKITKGKPTCTSYAIYSLNSNSNFTYGKAKKEL
GYNPRPIKETIYDTVLWLKERSLI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgattatagttactggtggaacaggtcatattggaaatgttttagtgaagagattgtta
ggaaggggttataaggtaaaaataatagtacctccaggtgaaaatttaacctctatattt
ggcttggatgttgaaattgaatttacagatgttcgaaataaaacttacctagttgattgt
ttcaaaggggccgaggttgtatttcaccttgcaagccttatttcaatttttacaaaagat
aaaagagtgtatgacgtaaatgtgtgtggaacagaaaatgtaatagaagcgtgcataaaa
aataatataaagaaacttgtttatgttagttcggtccatgcattaaaagaagaacctaaa
ggaaaagtaattaaggaaaacaaagattttaatccggcttacgtaaaaggtgattacgca
aaatcaaaagcaattgctacagcaaaagttttagaatcacaaaaattaggtatcgaacct
attgttgttcacccttcaggagttattggaccttatgattataaaatttcttttatgaat
caggttataattaattatttaatgggaaaatataagtttttaatagaaggtgcctataat
tttgttgatgtaagagatgtagcagaaggtataatactggcatgggagaaagggaaagca
ggcgaaaattatattctttcgggagaagtaattactatagaaaagctgttttcttatctt
gaagaaataacaggaataaaaaaacctcctattattaatagatatattggtgagtttttt
tcatactttgctgacatttactataaaataacaaaaggaaaacctacatgtacctcttat
gctatttatagtttaaatagtaattcaaatttcacttatggaaaagctaaaaaagaatta
ggatataatccgagacctataaaggaaacaatatatgatacagtgctttggcttaaagaa
agaagtttaatttag

DBGET integrated database retrieval system