KEGG   Thermoanaerobacter mathranii: Tmath_2133Help
Entry
Tmath_2133        CDS       T01250                                 

Definition
(GenBank) 4-diphosphocytidyl-2C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
tmt  Thermoanaerobacter mathranii
Pathway
tmt00900  Terpenoid backbone biosynthesis
tmt01100  Metabolic pathways
tmt01110  Biosynthesis of secondary metabolites
tmt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tmt00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Tmath_2133
Enzymes [BR:tmt01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Tmath_2133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_C GHMP_kinases_N CCDC117
Motif
Other DBs
NCBI-ProteinID: ADH61805
UniProt: D7AT09
Position
complement(2153541..2154410)
Genome map
AA seq 289 aa AA seqDB search
MKKIKVKAYAKINLSLDVLGKRKDGYHEISTVMQSIDLADILEFEKSEIVKVFCSGHRVP
EGEDNLIVKVINFLKEKYQIEEGVLVRLDKKIPLAAGLAGGSADAAATIVALDKLWNLNM
SADEKKEIALKVGADVPFCLEGGTKLAKGIGEIFEDLNVPHMNLLLVKPDIEIFTKKIYD
KWDRLNFKSHHATCSVVQAIQEGNIYKIAENIKNDLELVTSRECEVINQIKEELLKKGAL
GCAMSGSGPTVYGIFDDLQKLIKAYKDLEGIYSFVFFSKTIDKGLELYE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcaaagtaaaggcctatgcaaaaatcaatttgtctttagacgtgctaggt
aagagaaaagatggatatcatgaaatttctacagtgatgcaatcaattgatttggctgat
attttagagtttgaaaaaagcgaaatagttaaggttttttgtagtggccatcgagttcct
gaaggagaagataatttaatagtaaaggtcatcaactttttaaaagaaaaatatcaaata
gaagaaggagtgttagtcaggcttgacaagaaaatccctttagctgccggccttgctggg
ggaagtgctgatgctgctgctacaattgttgcattagacaaattatggaatttaaacatg
tcagcagatgagaaaaaagaaattgctttgaaagtgggagcagatgttcctttctgtctg
gaaggtgggacaaagcttgcaaaaggcataggggaaatttttgaagatttgaacgttcct
catatgaatttacttcttgtaaaacctgatattgaaattttcacaaaaaaaatttatgat
aaatgggataggcttaattttaaaagccatcatgctacttgttcagtagttcaagctata
caggaaggaaacatatacaaaattgcagaaaatataaaaaatgatttagaattagtaact
tctcgggaatgtgaagttattaatcaaataaaagaggagttgcttaaaaaaggtgcttta
ggatgtgctatgtcgggcagtggtcccactgtttatggaatttttgacgatttacaaaag
cttataaaagcctataaagatttagaaggaatttacagttttgtatttttttcaaaaact
atagataaggggttagaattgtatgaatga

DBGET integrated database retrieval system