KEGG   Trichechus manatus latirostris (Florida manatee): 101340289
Entry
101340289         CDS       T05135                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tmu01002]
    101340289
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101340289
Peptidases and inhibitors [BR:tmu01002]
 Metallo peptidases
  Family M1
   101340289
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N FPV060
Other DBs
NCBI-GeneID: 101340289
NCBI-ProteinID: XP_023585897
UniProt: A0A2Y9QUX2
Position
Unknown
AA seq 941 aa
MVSLSFQWPLATMSFLLFSLVTLLIVSAPSWCQSSDTTAPEASNGAPFPWNKVRLPEHVI
PVHYDLMIHANLTTLTFSGTTKVEITASQPTSTIILHSHHLQISKVTLKKGAGEGQSEDP
LRVLEYTPHEQIALLAPEPLLVGVPYTVVIDYAGNLSESFHGFYKSTYRTKKGEVRVLAS
TQFEPTAARMAFPCFDEPALKASFSIKIRREPRHLAISNMPLVKSVTIAEGLIEDHFDVT
VKMSTYLVAFIVSDFKSVSKMTKSGVKVSVYAVQDKINQTEYALDAAVTLLEFYDDYFSI
PYPLPKQDLAAIPDFQSGAMENWGLTTYRESALLFDAEKSSASSKLGITMTVSHELAHQW
FGNLVTMEWWNDLWLNEGFAKFMEYVSVRVTHPELKVEDYFLGKCFDVMEVDALNSSHPV
STPVENPAQIREIFDDVSYEKGSCILNMVRDYLGADAFKSGIVQYLQKYSYKNTKNEDLW
NSIASICPTGGTQGMDGFCSRGQHSSLSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRG
RNVHMKQEHYMKGSDDVPETGYLWHVPLTFITSKSDSVHRFLLKTKTDVLILPEEVEWIK
FNVGMNGYYIVHYEDDGWDSLTALLKRTHTTISSNDRASLINNAFQLVSVGKLPIEKALD
LTLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDE
GSVSERMLRSRLLLFACVCKYQPCVQRAEGYFREWKESSGNLSLPNDVTLAVFAVGAQNT
EGWEFLYSKYQSSLSSTEKNQIEFALCTSQNKEKLQWLLDQSFKGDIIKTQEFPGILMLI
GRNPVGYPLAWQFLKENWNKLVQKFGLGSPSITNMVMGTTNQFSTRTWLEEVKGFFSSLK
DNGSQLRCVQQTIEIIEENIRWMDKNFDKIRMWLQNENLGL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtctctgtccttccaatggccacttgcaactatgtcatttctgcttttctcactg
gtgactctcttgattgtgtcagctccttcatggtgccagagtagtgacactacagctcca
gaagctagtaatggggcaccatttccttggaataaagtgcgacttcctgagcatgtcatc
ccagttcattacgatctcatgatccatgcaaatctcaccactctgactttctcgggaacc
accaaggtagaaatcacagccagccagcccaccagtaccatcatcctgcatagtcaccat
ctgcagatatctaaggtgaccctcaagaaaggggctggagaggggcagtctgaagatcca
ctgagggtcctggaatacacgcctcacgagcaaatcgcacttctggctcccgagcccctc
cttgttggggtcccatacacagttgtcattgactatgctggcaacctttctgagagtttc
catggcttttataaaagcacctacagaaccaagaaaggggaagtgagggtacttgcatca
acgcagtttgaacctactgcagctcgaatggcctttccctgctttgatgagcctgccttg
aaagcgagtttctcaatcaagatcagaagggaaccaagacacctcgccatctccaatatg
cctttggtaaaatctgtgactattgctgaaggactcatagaagaccattttgatgtcact
gtgaagatgagcacctacctggtggccttcattgtttcagattttaagtctgtcagcaag
atgaccaagagcggagtcaaggtttctgtatatgctgtgcaagacaagataaatcagact
gagtatgcactggatgccgccgtgactcttctagaattttatgacgattatttcagcatt
ccatatcccttacccaaacaagatcttgctgctattcctgactttcagtctggtgcgatg
gaaaactggggactgacgacatatagagaatctgctttattgtttgatgcggaaaagtct
tctgcatcgagtaagcttggcatcacgatgactgtgtcccatgaacttgcccaccagtgg
tttgggaacctggtcaccatggaatggtggaatgatctttggctaaatgagggatttgcc
aagtttatggagtatgtgtctgtcagggtgacccatccagagctgaaagttgaagattat
ttccttggcaagtgttttgatgtgatggaagtagatgcgttgaattcttcacaccctgtg
tccacacctgtggagaatcctgctcagattcgggagatatttgatgatgtttcttatgag
aagggatcttgtattctgaatatggtaagagattatcttggtgccgatgcatttaaaagt
ggcattgtacagtatctccagaagtacagctataaaaacacaaaaaatgaggacctgtgg
aatagtatcgcaagtatttgtcctacaggtggcacacaagggatggatggcttttgttct
agaggtcaacattcatctttgtcctcacactggcgtcaggaaggccttgatgtgaaaacc
atgatgaacacctggacgctgcagaagggctttcccctgatcaccatcacagtgcgaggc
aggaatgtgcacatgaagcaagagcactatatgaagggatctgacgatgtcccagaaact
ggatacctgtggcatgttccattgacgtttattaccagcaaatcagactcggtccacaga
tttttgctgaagacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaa
tttaatgtgggaatgaatggctattacatcgtacattatgaggatgatggatgggactct
ttgactgctctcttaaaaagaacacacacaaccatcagcagtaatgatcgggccagtctc
attaacaatgcatttcagcttgtcagcgttggaaagctacccattgaaaaagccttggat
ttaaccctgtacttgaaacatgaaacggaaattatgcctgtgttccaaggtttgaatgag
ctgattcctatgtataaattaatggagaaaagagatatgaatgaagtagaaactcaattc
aaggccttcctcatcaggctgctgagggacctcattgataagcagacgtggacagacgag
ggctctgtctctgaacgaatgctgcggagtcggctcctcctctttgcttgtgtgtgcaag
taccagccatgtgtgcagagggcagaaggctattttagagagtggaaggaatccagtgga
aatttgagcttacccaatgatgtgaccttggcggtgtttgctgtgggggcccagaacact
gaaggctgggaatttctttatagtaaatatcagtcttctttgtccagtactgagaaaaac
caaattgaatttgccctctgtacgagccaaaataaggaaaagcttcagtggttattagat
caaagttttaagggagatataataaaaactcaggagtttccaggtattcttatgcttatt
ggcagaaatccagtgggatatccattggcctggcagtttctgaaggaaaattggaataag
cttgtacaaaagtttggccttggctcaccttccataaccaacatggtaatgggaacaaca
aatcaattctccacaagaacttggcttgaagaggtgaaaggattcttcagctctttgaaa
gacaatggttctcagctccgttgtgtccaacaaacaattgaaatcattgaggaaaacata
cgttggatggataagaattttgataaaattagaatgtggttacagaatgaaaaccttggg
ctgtaa

DBGET integrated database retrieval system