KEGG   Trichechus manatus latirostris (Florida manatee): 101342451Help
Entry
101342451         CDS       T05135                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00020  Citrate cycle (TCA cycle)
tmu00640  Propanoate metabolism
tmu01100  Metabolic pathways
tmu01200  Carbon metabolism
Module
tmu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tmu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    101342451
   00640 Propanoate metabolism
    101342451
Enzymes [BR:tmu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     101342451
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     101342451
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 101342451
NCBI-ProteinID: XP_004388306
UniProt: A0A2Y9E6R5
Position
Unknown
AA seq 376 aa AA seqDB search
MEIRSGDFSSHPPSPRASAPARSPGAWECHWWMTAVLGAAAVIMASGSSGLAASRLLTRY
FLVQRNGIRHCSYASSRNHLYIDKNTKVICQGFTGKQGTFHSQKALDYGTKLVGGTTPGK
GGKMHLDLPVFNTVKEAKEKTGATASVIYVPPPFAAAAINEALEAEMPLVVCITEGIPQQ
DMVRVKHALLRQGKTRLVGPNCPGVINPGECKIGIMPGHIHKKGRVGIVSRSGTLTYEAV
HQTTQVGLGQSLCVGIGGDPFNGTDFIDCLEVFLKDPATEGILLIGEIGGNAEEDAAEYL
KQHNSGPNAKPVVSFIAGLTAPPGRRMGHAGAIIAGGKGGAKEKISALQSAGVVISMSPA
QMGSTIYKEFEKRKML
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggaaattcgttcaggcgacttctctagtcaccctccttctcctcgtgcctcagcccct
gccaggtccccgggggcctgggagtgtcattggtggatgaccgcagtcttaggtgctgcc
gctgtgatcatggcctccggtagcagcggccttgccgcctcccgcctcctgacacgctat
ttcctcgtgcagcggaatggaattcgacattgttcttatgcgtcttcccggaaccatctc
tatatcgataaaaatacaaaagttatttgccagggtttcactggtaagcagggcaccttt
cacagccaaaaggcattagactatggcaccaaacttgttggaggaacaaccccagggaaa
ggaggcaagatgcatctggacttacctgtctttaatactgtgaaggaggccaaagaaaag
acaggagcgacagcatctgttatttatgtccctcctccttttgctgctgctgcaattaat
gaagctcttgaggcagaaatgcccttggttgtgtgcattaccgaaggtattccccagcag
gacatggtacgggtcaagcacgcgctgctgcgccagggaaagacaaggctggtcgggcca
aactgccctggagtcatcaatcctggagaatgtaaaattggtatcatgcctgggcatatt
cacaagaaaggaagagttggtattgtgtccagatctggcaccctgacttacgaagcagtt
caccaaacaacgcaagttggattggggcagtctttgtgtgttggcattggaggtgatcct
tttaatggaacagattttattgactgccttgaagtctttctcaaagatccagccacagaa
ggcatcttactgattggtgaaattggtggtaatgcagaagaagatgctgcagaatatttg
aagcaacataattcaggtccgaatgccaagcctgtggtgtccttcattgctggtttaact
gctcctcctggcagaagaatgggtcacgcaggggcaattattgctggggggaaaggtgga
gcgaaagagaagatctcagcccttcagagtgccggagttgtgatcagcatgtctcctgca
cagatgggaagcaccatctacaaggaatttgaaaagaggaagatgctatga

DBGET integrated database retrieval system