KEGG   Trichechus manatus latirostris (Florida manatee): 101342782Help
Entry
101342782         CDS       T05135                                 

Definition
(RefSeq) septin-7 isoform X2
  KO
K16944  septin 7
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tmu04131]
    101342782
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:tmu04812]
    101342782
   04147 Exosome [BR:tmu04147]
    101342782
Membrane trafficking [BR:tmu04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    101342782
Cytoskeleton proteins [BR:tmu04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     101342782
Exosome [BR:tmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101342782
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin MMR_HSR1 RsgA_GTPase AIG1 AAA_16 GTP_EFTU AAA_22 Ras FeoB_N ABC_tran AAA_29 Roc Gtr1_RagA Fez1
Motif
Other DBs
NCBI-GeneID: 101342782
NCBI-ProteinID: XP_004385364
UniProt: A0A2Y9E386
Position
Unknown
AA seq 436 aa AA seqDB search
MSVSARSAAAEERSVNSSTMAQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGL
GKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAV
DNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMK
RLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPETDDEEENKLVKKIK
DRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVT
NNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVF
EMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQRILEQQ
NSSRTLEKNKKKGKIF
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtcagtgcgagatccgctgctgctgaggagaggagcgtcaacagcagcaccatg
gctcaacagaagaaccttgaaggctatgtgggatttgcaaatctcccaaatcaagtatac
agaaaatcagtgaaaagagggtttgaattcacgcttatggtagtaggtgaatctggattg
ggaaagtcaacgttaatcaactcgttattcctcacagatttgtattctccagagtatccg
ggtccttcccataggataaaaaagactgtacaggtggaacaatccaaagttttaatcaaa
gaaggtggagttcagttactgctcacgatagttgataccccaggatttggagatgcagtg
gataatagtaattgctggcagcctgttatcgattacatcgatagtaaatttgaagactac
ttaaatgcagaatctcgagtgaacagacgtcagatgcctgacaacagagtgcagtgttgt
ttatacttcattgctccttcaggacatggacttaaaccattggatattgagtttatgaag
cgcttacatgaaaaagtgaatatcatcccacttattgccaaagcagacacactcacacca
gaggagtgccaacagtttaaaaaacagataatgaaagaaatccaagaacataaaattaaa
atatatgaatttccagaaacagatgatgaagaagaaaataagcttgttaaaaagataaag
gaccgtttacctcttgctgtggtaggtagtaatactatcattgaagttaatggcaaaagg
gtcagaggaagacagtatccttggggtgttgctgaagttgaaaatggtgaacattgtgat
tttacaattctaagaaatatgttgataagaacacacatgcaggacttgaaagatgtcact
aataatgtacactatgagaactacagaagcagaaaactggcagctgtgacttataatgga
gttgataacaacaagaataaagggcagcttacaaagagccctctggcacaaatggaagaa
gaaagaagggagcatgtagccaagatgaagaagatggagatggagatggagcaggtgttt
gaaatgaaggtcaaagaaaaagttcagaaattgaaggactctgaagctgagctccagcgg
cgtcatgagcaaatgaaaaagaatttggaagcacagcacaaagaattagaggaaaaacgc
cgtcagtttgaggatgagaaagcaaactgggaagctcaacaacgtatattagaacaacag
aactcttcgagaactttggaaaagaacaagaagaaagggaagatcttttaa

DBGET integrated database retrieval system