KEGG   Trichechus manatus latirostris (Florida manatee): 101342899Help
Entry
101342899         CDS       T05135                                 

Definition
(RefSeq) neuronal acetylcholine receptor subunit alpha-4 isoform X1
  KO
K04806  nicotinic acetylcholine receptor alpha-4
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04080  Neuroactive ligand-receptor interaction
tmu04725  Cholinergic synapse
tmu05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101342899
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    101342899
 09160 Human Diseases
  09165 Substance dependence
   05033 Nicotine addiction
    101342899
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:tmu04040]
    101342899
Ion channels [BR:tmu04040]
 Ligand-gated channels
  Acetylcholine (nicotinic)
   101342899
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Neur_chan_memb Neur_chan_LBD DUF2417
Motif
Other DBs
NCBI-GeneID: 101342899
NCBI-ProteinID: XP_004370239
UniProt: A0A2Y9D8Z9
Position
Unknown
AA seq 613 aa AA seqDB search
MELGGLGAPPLLLLLLGAGLLPASSHVETRAHAEERLLKKLFSGYNKWSRPVANISDVVL
VRFGLSIAQLIDVDEKKQMMAVNVWVKQEWRDYKLRWDPADHENVMSIRIPSELIWRPDI
VLYNNADGDFAVTHLTKAHLFHDGRVQWTPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWT
YDKAKIDLVSMHRRVDQLDYWESGEWVIVDAVGNYNTKKYECCAEVYPDITYAFIIRRLP
LFYTINLIIPCLLISCLTVLVFYLPSECGEKVTLCVSVLLSLTVFLLLITEIIPSTSLVI
PLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPRTHTMPAWVRRVFLDIAPRLLLMKRPSV
VKDNCRRLIESMHKMASAPCFWPEPEGQPGFLSRDLSPSKSCCASPGEPVKPPSEQPPDL
QPVEAGKASTCPLAGPGPLLSSSQATGLPKARSLSVQHMTSPGKVEDSSVRCRSHSIQYC
VSRDDASTQAKGQVTSAPASAHSAKPTAPDQPSPCKCKCRKEPPATSPDATFTAHSTKVP
CRHLLLSPALARAVEGVQYIADHLKAEDTDFSVKEDWKFVAVVIDRIFLWVFVTACLLGT
IGLFLPPWLAGMI
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggagcttgggggcctcggggcgccgccgctgctgctgctgcttctcggggccggcctc
ctgcccgcaagcagccacgtggagacccgagcccacgccgaggagcggctgctgaagaaa
ctcttctctggctacaacaagtggtcccggcctgtggccaacatctcagatgtggtcctg
gtccgcttcggcctgtccattgcccagctcatcgatgtggacgagaagaagcagatgatg
gcagtgaacgtgtgggtgaagcaggagtggcgtgactacaagctgcgctgggacccggct
gaccacgagaacgtgatgtccatccgcatcccctcggagctcatctggcggccggacatt
gtcctctacaacaatgcggatggggactttgcagtgacgcacctgaccaaagcccacctc
ttccacgacggacgggtccagtggacgcccccggccatctacaagagctcctgcagcatc
gacgtcaccttcttccccttcgaccagcagaactgcaccatgaagtttgggtcctggacg
tatgacaaggcgaagatcgacctggtgagcatgcaccgacgcgtggaccagctggactac
tgggagagcggcgagtgggtgatcgtggatgccgtgggcaactacaataccaagaagtac
gagtgctgtgccgaggtctaccccgacatcacctacgccttcatcatccggcgcctgccg
ctcttctacaccatcaacctcatcatcccgtgtctgctcatctcctgcctcacagtgctg
gtcttctacctgccgtccgagtgcggtgagaaggtcacactctgcgtctccgtgctcctc
tcgctcaccgtcttcctgctgctcatcaccgagatcatcccgtccacctcgctggtcatc
ccgctcatcggcgagtacctgctcttcaccatgatctttgtcacgctctccatcattatc
accgtcttcgtactcaacgtgcaccaccgctccccgcgcacgcacaccatgcctgcctgg
gtgcgcagggtcttcctggacatcgcgccccgcctgctcctcatgaagcggccgtccgtg
gtcaaggacaactgccggcggctcatcgagtccatgcacaagatggccagcgccccgtgc
ttctggccagagcctgagggccagcccggcttcctgagccgggacctgtcgccctccaag
tcctgctgtgcctcaccgggggagccagtcaagccgccctcagagcagccccccgatctc
cagcccgtggaggccgggaaggccagcacctgccccttggctggccctggccccctgctc
agcagcagccaggccacagggctgcccaaggccaggtctctgagtgtccagcacatgacc
agccccggtaaagtggaggacagcagcgtccggtgccgatcccacagcatccagtactgt
gtcagccgagatgacgcctctacccaggccaaaggccaggtgaccagtgccccggcctcc
gctcactccgccaagcctacggccccagaccagccctctccctgcaaatgcaagtgcaga
aaggagccgcctgccacctcccccgatgccacattcacagctcacagcaccaaagtgccc
tgtcgccacctgctcctgtcgccggccctggctcgggctgtggagggagtccagtacatt
gcggaccacctgaaggcagaggacacggatttctcggtaaaggaggactggaagttcgtg
gctgtggtcatcgaccgcatcttcctctgggtgtttgtcactgcctgcctgctgggcacc
attggcctcttcctgccgccctggctggccggcatgatctag

DBGET integrated database retrieval system