KEGG   Trichechus manatus latirostris (Florida manatee): 101343201
Entry
101343201         CDS       T05135                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00100  Steroid biosynthesis
tmu01100  Metabolic pathways
Module
tmu_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    101343201
Enzymes [BR:tmu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     101343201
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 101343201
NCBI-ProteinID: XP_004383804
UniProt: A0A2Y9E0A0
Position
Unknown
AA seq 417 aa
MAPHGPRAPLEFGGPLGAAALMLLLPATMFYLLLVARSGPARLLGPPPYLPGLQALWSPR
ALLLCLAWLGLQAALYLLPARKVAEGQELKDKSRLQYPINGFQALVLTALLAGLGVLAGL
PLAALPEMLLPLAFAATLIAFVFSLLLYLKSQVAPASALAPGGSSGNPIYDFFMGRELNP
RICFLDFKYFCELRPGLIGWVLINLALLVQEAELRGSPSLAMWLVNGFQLLYVGDALWHE
EAVLTTMDITHDGFGFMLVFGDLAWVPFTYSLQAQFLVHHPQALGLPMASTICLINAIGY
YIFRGANSQKNTFRKNPSDPRVADLETISTATGRQLLVSGWWGMVRHPNYLGDLIMALAW
SLPCGASHLLPYFYLLYFTSLLVHREAHDERQCLQKYGLAWHEYCRRVPYRIVPYIY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atggcccctcacggccctcgagccccgctggaattcggggggccgctgggcgctgcggcg
ctgatgctgctgctccctgccaccatgttctacttgctcctggtggcccgctcggggccg
gcgcgcctcctgggcccgcccccttacctgccggggctccaggcgctgtggagcccgcgg
gcgctgctgctgtgtctcgcctggctcggcctacaggcggcgctctacctactgccggcg
cgcaaggtggccgaggggcaggagttgaaggacaagagtcgcctgcagtaccccattaac
ggcttccaggccctggtactgacagccctgttagcagggctgggggtgttagccggtctg
cccctggcggcgctcccagaaatgctcctgcccttggcgtttgccgccaccctcatcgcc
ttcgtcttcagcctccttctctatctgaagtcccaggtagctcctgcctcggccctggca
cccggggggagctcaggcaatcccatttacgactttttcatgggacgggagctcaacccg
cgcatctgtttcttggacttcaaatatttctgcgaactgcggcctggcctcatcggctgg
gtcctcatcaacctggccctgctggttcaagaggcagagctgcggggcagtccctcattg
gccatgtggttggtcaatggcttccagctactctatgtgggtgatgctctttggcacgag
gaggccgtccttaccaccatggacatcacacatgatgggtttggcttcatgctggtcttt
ggggacttagcctgggtacccttcacctacagcctgcaggcccagttcctggtgcaccat
ccacaggccctggggctgcccatggcctccaccatctgcctcatcaacgctattggttac
tacatcttccgtggggccaattcccagaaaaacaccttccgaaagaatccttctgacccc
agagtggctgacctcgagaccatctctacagccacggggcggcagctgctggtgtctggg
tggtggggtatggtccgccatcccaactaccttggagacctcatcatggctctggcctgg
tccctgccctgcggggcttcccacttgctgccctacttctacctcctctacttcacttcg
ctgctggtgcaccgggaggcacatgatgagcggcagtgcctgcagaagtatggtttggcc
tggcatgagtactgccggcgtgtgccttaccgcatcgtgccctacatctactga

DBGET integrated database retrieval system