KEGG   Trichechus manatus latirostris (Florida manatee): 101343223Help
Entry
101343223         CDS       T05135                                 

Definition
(RefSeq) rho-associated protein kinase 1 isoform X1
  KO
K04514  Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04062  Chemokine signaling pathway
tmu04071  Sphingolipid signaling pathway
tmu04270  Vascular smooth muscle contraction
tmu04350  TGF-beta signaling pathway
tmu04360  Axon guidance
tmu04510  Focal adhesion
tmu04530  Tight junction
tmu04611  Platelet activation
tmu04670  Leukocyte transendothelial migration
tmu04810  Regulation of actin cytoskeleton
tmu04921  Oxytocin signaling pathway
tmu05132  Salmonella infection
tmu05135  Yersinia infection
tmu05163  Human cytomegalovirus infection
tmu05200  Pathways in cancer
tmu05205  Proteoglycans in cancer
tmu05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    101343223
   04071 Sphingolipid signaling pathway
    101343223
   04024 cAMP signaling pathway
    101343223
   04022 cGMP-PKG signaling pathway
    101343223
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101343223
   04530 Tight junction
    101343223
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101343223
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101343223
   04670 Leukocyte transendothelial migration
    101343223
   04062 Chemokine signaling pathway
    101343223
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101343223
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101343223
  09158 Development and regeneration
   04360 Axon guidance
    101343223
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101343223
   05206 MicroRNAs in cancer
    101343223
   05205 Proteoglycans in cancer
    101343223
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    101343223
   05135 Yersinia infection
    101343223
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101343223
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343223
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tmu03036]
    101343223
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101343223
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: AGC group
  DMPK family [OT]
   101343223
Chromosome and associated proteins [BR:tmu03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101343223
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rho_Binding PH C1_1 HR1
Motif
Other DBs
NCBI-GeneID: 101343223
NCBI-ProteinID: XP_023580466
UniProt: A0A2Y9QG20
Position
Unknown
AA seq 959 aa AA seqDB search
MQNDSINLAVFKFFVNIFSRMSFYFYLKQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTS
NIKLDKIMKELDEEGSQRRNLESTVSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEV
STLKDQLEDLKKLSLNSQLANEKLAQLQKQLEEANDLLRTESDTAARLRKSHTEMSKSIS
QLESLNRELQERNRILENSKTETDKDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQE
EVKHLKHNLERMEGERKEAQDMLNHSEKEKNNLEIDLNYKLKLLQQRLEQEVNEHKVTKA
RLTDKHQSIEEAKSVAMCEMEKKLKEEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLE
HMTENKERMEDEVKNLALQLEQESNKRLLLQSELKTQAFEADHLKGLEKQMKQEINTLLE
AKRLLEFELAQLTKQYRGNEGQMRELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLK
KIQELQNEKEALATQLDLAETKAESEQLARGLLEEQYFELTQESKKAASRNRQEITDKDH
IVSQLEEMNSMLTKDIELLKKENEELTENMRKTEEEYKLKKEEEISNLKAAFEKNINTER
TLKTQAVNKLAEIMNRKDFKIDRKKANMQDLRKKEKENRKLQLELNQEREKFNQMVVKHQ
KELNDMQAQLAEESTHRNELQMQLASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNL
PESRIEGWLSVPNRGNIKRYGWKKQYVVVSSKKILFYNDEQEKEQSNPSMVLDIDKLFHV
RPVTQGDVYRAETEEIPKIFQILYANEGECRKEVEMEPVQQAEKANFQNHKGHEFIPTLY
HFPANCEACAKPLWHVFKPPPALECRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDML
LLACSQDEQKKWVTHLVKKIPKNPPSSFVRASPRTLSTRSAANQSFRKVVKNTSGKTSS
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgatagcataaacttggctgtttttaaattctttgtgaatattttcagtaga
atgagtttttatttttatttaaagcaggaaagtttgcagaaaacaatctacaagttggaa
gaacagctacataatgaaatgcaattaaaagatgaaatggagcagaagtgcagaacttca
aacataaaactagacaagataatgaaagaattggatgaagaggggagtcaaagaagaaat
ctagaatctacggtgtctcagatagaaaaggagaaaatgttgttacagcatagaattaat
gagtaccagagaaaagctgaacaggaaaatgagaagaggaggaatgtagaaaacgaagtt
tctacattaaaggatcagttggaagacttgaagaaattaagtctgaattcacagcttgct
aatgagaagttggcacaattacaaaagcagctagaagaagccaatgacttacttaggaca
gaatcagacacagctgcaagattaaggaagagtcacacagagatgagcaagtcaattagt
cagctagagtccctgaacagagaattgcaagagagaaatagaattttagagaattccaag
acagaaacggacaaggattattaccagctgcaagctgtgttagaagctgaacgaagagac
agaggccatgattctgagatgattggagaccttcaagctcgaattacatctttacaagag
gaagtgaagcatctcaaacacaatcttgaaagaatggaaggagaaagaaaagaagctcaa
gacatgcttaatcattcagaaaaggaaaagaataatttagagatagatttaaactacaag
cttaaattgttacaacaacggttagaacaagaagtaaacgaacataaagtaaccaaagct
cgtttaactgacaaacatcagtctattgaagaagcaaagtctgttgcaatgtgtgagatg
gaaaaaaagctgaaggaagaaagagaggctcgagaaaaggctgaaaatagggttgttcag
attgagaaacagtgttctatgctcgatgttgatctaaagcagtctcagcagaagctagag
catatgactgaaaataaagaaaggatggaggatgaagttaagaatctagccctgcaactg
gagcaggaatcaaataagcgtctgctgttacaaagtgaattgaagacacaagcttttgag
gcagaccatttaaaaggtttagagaagcagatgaaacaggaaataaatactttattggaa
gcaaagagattattagaatttgagttagctcagcttacaaaacagtatagaggaaatgaa
ggacagatgcgggagctacaagatcagcttgaagctgagcagtatttctcgacactgtat
aaaacccaggtaaaggaacttaaagaagaaattgaagaaaaaaacagagaaaatttaaag
aaaatacaggaactgcaaaatgaaaaagaagctcttgctactcagttggatctagcagaa
acaaaagctgagtctgagcagttggctcgagggcttctggaagaacagtattttgaattg
acccaagaaagcaagaaagccgcttcaagaaatagacaagagattacagataaagatcac
attgttagtcagctagaagaaatgaacagcatgctaaccaaagatattgaattattaaaa
aaagaaaatgaagagctaactgaaaacatgaggaagacagaggaagaatataaattgaag
aaggaagaggaaatcagtaatcttaaggctgcctttgaaaagaatatcaatacagaacga
accctcaaaacacaggctgttaacaagttggcagaaataatgaatcgaaaagattttaaa
attgatagaaagaaagctaatatgcaagatttaagaaagaaggaaaaggaaaatcgaaaa
ctacagctggaactcaaccaagaaagagagaaattcaaccagatggtagtgaaacatcag
aaggaactgaatgacatgcaggcgcaattggcagaagaaagtacacataggaatgaactt
cagatgcagttggctagcaaagagagtgatattgagcagttgcgtgctaaacttttagac
ctttcggattccacaagtgttgctagttttcctagtgctgatgaaactgacggaaacctt
ccagagtcaagaattgaaggttggctttcagtaccaaacagaggaaatatcaaacgatac
ggctggaagaaacagtatgttgtggtaagcagcaaaaaaattttgttctataatgatgaa
caagaaaaggaacaatccaatccatctatggtattggatatagataaactgtttcatgtt
cgacctgtaacccaaggggatgtgtacagagctgaaactgaagaaattcctaaaatattc
cagatattatatgcaaatgaaggtgaatgtagaaaagaagtagagatggaaccagtacaa
caagctgaaaaagccaattttcaaaatcacaaaggtcatgagttcatcccaacactctac
cacttcccagccaactgtgaggcctgtgccaaacctctctggcatgttttcaagccaccc
cctgccctggaatgtcgaagatgccatgtaaagtgccacagagaccatttagataagaaa
gaggacttgatttctccctgtaaagtaagttatgatgtaacatcagcaagagatatgctg
ctgttagcatgttctcaggatgaacaaaagaaatgggtaactcatttagtaaagaagatc
cctaagaatccaccgtccagttttgttcgcgcatcccctcgaacactttctacaagatct
gctgcaaatcagtctttcagaaaagtggtaaaaaatacatctggaaaaactagcagttaa

DBGET integrated database retrieval system