KEGG   Trichechus manatus latirostris (Florida manatee): 101343253Help
Entry
101343253         CDS       T05135                                 

Definition
(RefSeq) calcium/calmodulin-dependent protein kinase type IV isoform X3
  KO
K05869  calcium/calmodulin-dependent protein kinase IV [EC:2.7.11.17]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04020  Calcium signaling pathway
tmu04024  cAMP signaling pathway
tmu04211  Longevity regulating pathway
tmu04371  Apelin signaling pathway
tmu04380  Osteoclast differentiation
tmu04720  Long-term potentiation
tmu04722  Neurotrophin signaling pathway
tmu04725  Cholinergic synapse
tmu04921  Oxytocin signaling pathway
tmu04925  Aldosterone synthesis and secretion
tmu05031  Amphetamine addiction
tmu05034  Alcoholism
tmu05214  Glioma
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101343253
   04020 Calcium signaling pathway
    101343253
   04024 cAMP signaling pathway
    101343253
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101343253
   04925 Aldosterone synthesis and secretion
    101343253
  09156 Nervous system
   04725 Cholinergic synapse
    101343253
   04720 Long-term potentiation
    101343253
   04722 Neurotrophin signaling pathway
    101343253
  09158 Development and regeneration
   04380 Osteoclast differentiation
    101343253
  09149 Aging
   04211 Longevity regulating pathway
    101343253
 09160 Human Diseases
  09162 Cancer: specific types
   05214 Glioma
    101343253
  09165 Substance dependence
   05031 Amphetamine addiction
    101343253
   05034 Alcoholism
    101343253
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101343253
Enzymes [BR:tmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     101343253
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: CAMK group
  CAMK1 family [OT]
   101343253
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 Kdo ApoLp-III Pkinase_fungal APH YrbL-PhoP_reg SDP_N
Motif
Other DBs
NCBI-GeneID: 101343253
NCBI-ProteinID: XP_004377059
UniProt: A0A2Y9DM22
Position
Unknown
AA seq 472 aa AA seqDB search
MLKVTVPSCSASSCSSVTASTAPGAGSLVPDYWIDGSNRDALSDFFEVESELGRGATSIV
YRCKQKGTQKPYALKVLKKTVDKKIVRTEIGVLLRLSHPNIIKLKEIFETPTEISLVLEL
VTGGELFDRIVEKGYYSERDAADAVKQILEAVAYLHENGIVHRDLKPENLLYATPAPDAP
LKIADFGLSKIVEHQVLMKTVCGTPGYCAPEILRGCAYGPEVDMWSVGIITYILLCGFEP
FYDERGDQFMFRRILNCEYYFISPWWDEVSLNAKDLVRKLIVLDPKKRLTTFQALQHPWV
TGKAANFVHMDTAQKKLQEFNARRKLKAAVKAVVASSRLGSASSHSSIQESQKASRDPSP
VQDGNQDIKAIAEEENVPGDGAQVSFEGAEAELMKEQALGEIKDVDINAAEATKMAPEAL
DDGIKVAEPEIEEGLTEEKLKTVEEAADLKEAQENPDLELGAQQYDVNLPEY
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgctcaaagtcacggtgccctcctgctccgcctcgtcctgttcctcggtcaccgccagt
acggccccgggggccgggagcctcgtcccggattactggatcgacggttccaacagggac
gctctgagcgatttcttcgaggtggagtcggagctgggacggggtgctacatccattgtg
tacagatgcaaacagaaggggacccagaagccttatgctctcaaagtgttaaagaaaaca
gtggacaaaaaaatcgtgagaactgaaataggagttcttcttcgcctctcacatccaaac
attataaaacttaaagagatatttgaaacccctacagaaatcagtctggtcctagaactc
gtcacaggaggagagctgtttgacaggattgtggaaaaaggatattatagtgagcgagat
gctgcagatgctgttaaacaaatcctggaggcagtcgcttacctacatgaaaatgggatt
gtccatcgtgatcttaaaccagagaatcttctctatgcaactccagccccagatgcacca
ctcaaaattgctgattttggactctctaaaattgtggaacatcaagtgctcatgaagaca
gtatgtggaaccccagggtactgcgctcctgaaattctcagaggctgtgcctatggacct
gaggtggacatgtggtctgtaggaataatcacctatatcttactttgtggatttgaacca
ttttatgatgaaagaggagatcagttcatgttcaggagaattctgaattgtgaatattac
tttatctccccgtggtgggatgaagtatctctaaatgccaaggatttggtcagaaaatta
attgttttggatcctaagaaacggctgactacctttcaagctctccaacacccgtgggtc
acaggaaaagcagccaattttgtacacatggatactgcacaaaagaagctccaagaattt
aatgcccggcgcaagcttaaggcagcagtgaaggcggtggtggcctcttcccgactggga
agtgccagcagtcacagcagcatccaggagagccagaaagccagccgagacccatcccca
gtccaagatggcaaccaggacatcaaagctattgcagaggaagagaacgttccaggagat
ggggcccaagtgtcatttgagggggcagaggctgagctgatgaaggagcaggccttaggg
gaaattaaagatgtagatataaatgctgctgaggccaccaagatggcaccagaagcactg
gatgatgggataaaggtggctgagccggaaatagaagagggcctaacagaggaaaagctg
aagacggtggaggaagcagcagaccttaaagaagcgcaggaaaaccctgatctggaactt
ggagctcaacagtatgatgtaaacctgccagagtactaa

DBGET integrated database retrieval system