KEGG   Trichechus manatus latirostris (Florida manatee): 101343442
Entry
101343442         CDS       T05135                                 

Definition
(RefSeq) aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:tmu03000]
    101343442
Transcription factors [BR:tmu03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101343442
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4 PAS_9
Other DBs
NCBI-GeneID: 101343442
NCBI-ProteinID: XP_012412089
UniProt: A0A2Y9G1G2
Position
Unknown
AA seq 721 aa
MIPPGECLYAGRKRRKPIQKQRPALESEKSNPSKRHRDRLNAELDHLASLLPFPADIISK
LDKLSVLRLSVSYLRVKSFFQAVQETGSQLPVAGDPSSGDGHPPGGSEVLEGRLLLESLN
GFALVVSAEGMIFYASATIVDYLGFHQTDVMHQNVYDYIHVDDRQDFCRQLHWAMDPPSA
ALGQPTLPETGDDAVLRRLLQAQDPGAGPPSEFAAFLTRCFVCRVRCLLDSTSGFLTMQF
QGKLKFLFGQKKKAPSGTVLPPRLSLFCVAVPVLLPSVAEMRMKTALLRAKPRADAGATT
DTKAKATPSLCESELHGKPSNIAGRSNGENGIPVFRAHADADRWARAPARAPCLCLGGND
LVLDPEGAAGDREEEAHGRMLSSSSGARGQREVHLYNCRLEAAGKMRHLGWTTERHSQGR
SAKLQPQPCGNGPFSMCAEPRGTCVPYAGVQGTFDASGSAAFRNAPSAHPLDHPPSAHCG
RTSRPWRDCDQALVSPLTSCHLPHSGAQRFPTGGYSAEDAKLRSAPVPPRALGNPMMSLD
VPIKVENDSGSEDTAEGYPKPRSQVWLGASDLAKRQPVSFPNRMHLKTEPDLPAHLPRCA
DSRHFTYTPHLGPSVLGPHANCRATARPSPSYPAGCACLERMCGLPGPEPAHCPQQEPGA
RCPCPLRRDGRAPGAAPVVKSEPLDSLPWAKHSQGGVPGMLPKSALAALMPPKAPECMFL
P
NT seq 2166 nt   +upstreamnt  +downstreamnt
atgatcccaccaggggagtgtctgtacgctgggaggaagaggaggaagcccattcagaaa
cagaggcctgctctggagtctgagaagtccaacccttccaagaggcaccgggatcgcctc
aatgccgagctggaccatctggccagcctcctgccgtttccagctgacatcatctccaaa
ctggacaagctttctgtcctgcgtctgagtgttagttacctaagggtgaagagcttcttc
caagctgtgcaggagacaggctcgcagctgccagtggccggggacccctcgtcaggagat
ggccacccgcctggagggtctgaggtgctggagggacggctgctgctggagtctctcaat
ggctttgccctggtggtgagcgcagaagggatgatattttatgcatcagcaaccattgtg
gactatctgggctttcaccagacggacgtgatgcaccagaacgtgtacgattacatccac
gtggacgaccgccaggacttctgccgacagctgcactgggccatggacccaccctcggca
gcactagggcagcccacactcccagagacaggagacgacgccgtactgcggaggctgctc
caggcccaggacccgggtgccggcccgccttccgagttcgccgcctttctgacgcgctgc
ttcgtgtgccgcgtgcgctgcctgctggacagcacttcgggcttcctgacaatgcagttt
caaggaaaactgaagttcctgtttgggcagaagaagaaggcaccgtcggggacagtcctg
ccaccccggctctcgctgttctgcgtggcagtgccagttcttctgccctctgtggcagag
atgaggatgaagactgctcttctgcgggccaagcccagggcggacgctggggccacgacg
gacaccaaggcaaaagctaccccgagcctgtgtgaatcagaattgcacggaaagcccagt
aacattgcaggaaggagcaatggagagaacggcatcccggtgttcagagcgcacgcggac
gccgaccgctgggcccgggctccggccagggccccatgcctgtgccttggtggcaacgac
ctcgtccttgaccctgagggggctgcaggggacagggaagaagaggcacatgggaggatg
ctgagcagctcctcgggagcaagggggcaaagggaagtacacctgtacaattgccgcttg
gaagcagccgggaagatgaggcatcttggctggacgacagagaggcacagccagggcagg
agcgccaagctgcagccacagccctgtgggaatggcccgttctccatgtgcgccgagccc
cgaggcacctgcgtcccctacgcgggcgtccagggcactttcgatgctagtgggagcgct
gctttcagaaatgcacccagcgcccacccgctggaccacccccccagtgcccactgtggc
cggaccagcagaccttggcgggattgcgaccaggccctggtgtccccactcaccagctgc
cacctcccccactccggggcacagcgattccccacggggggctattctgccgaggatgcc
aagttgcgaagtgcaccagtgcccccgagagccttgggcaacccaatgatgtcgctggat
gtacccatcaaagtagaaaatgattctggttctgaggacacagccgaaggctaccccaag
ccccggagccaggtgtggctgggagccagtgacctggccaagagacagccggtcagcttc
cctaacaggatgcacctgaagacagagccggacctcccggcgcacctgccccgatgcgcg
gactccaggcacttcacctacaccccgcacctcgggcccagcgtgctggggcctcacgcc
aactgcagggccacggccagaccaagcccctcctacccagccggctgcgcctgcctggag
cgcatgtgcggccttcccgggccggagcctgcccactgcccgcagcaggagcccggtgcg
cgctgtccgtgcccgctgcggcgcgacggcagggcgcccggggccgcgcccgtcgtcaag
agcgaacccctggactcactgccgtgggccaaacacagccagggtggggtgccggggatg
ctccccaaaagtgccctggcagcgctgatgccgcccaaagccccggagtgcatgttcctg
ccgtag

DBGET integrated database retrieval system