KEGG   Trichechus manatus latirostris (Florida manatee): 101344884Help
Entry
101344884         CDS       T05135                                 

Definition
(RefSeq) cathepsin O
  KO
K01374  cathepsin O [EC:3.4.22.42]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu04142  Lysosome
tmu04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    101344884
  09143 Cell growth and death
   04210 Apoptosis
    101344884
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:tmu01002]
    101344884
Enzymes [BR:tmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.42  cathepsin O
     101344884
Peptidases [BR:tmu01002]
 Cysteine Peptidases
  Family C1: papain family
   101344884
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C1 Peptidase_C1_2 Peptidase_C39_2
Motif
Other DBs
NCBI-GeneID: 101344884
NCBI-ProteinID: XP_023592369
UniProt: A0A2Y9RK83
Position
Unknown
AA seq 221 aa AA seqDB search
MSISNISLPVRFDWRDKHVVTQVRNQQMCGGCWAFSVVGAVESACAIKGKPLEDLSVQQV
IDCSYSNYGCNGGSTLNALNWLNKMQVKLVRDSEYPFKAQNGLCQYFSVSHSGFSIKGYS
AYDFSDQEDEMAKALLTFGPLVVIVDAVSWQDYLGGIIQHHCSSGEANHAVLITGFDKTG
STPYWIVRNSWGRSWGVDGYAHVKMGANICGIADSVSAVFV
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatctccaacatatccttgccagtaagatttgactggagagacaagcatgttgta
acgcaagtaagaaaccagcagatgtgtggaggctgctgggccttcagcgtggtaggtgcg
gtggaatctgcatgtgcgatcaaagggaagcctctggaagacctgagtgtacagcaggtc
attgattgttcatacagcaattatggctgcaatggagggtctacactcaatgctttgaac
tggttaaataagatgcaagtaaaactggtgagagattcagaatacccatttaaagcacaa
aacggcctgtgccaatatttttctgtttcacattctggattttcaatcaaaggttattct
gcatatgacttcagtgaccaagaagatgaaatggcaaaagcacttcttacctttggccct
ttggtagtgatagtagatgccgtgagctggcaggattatctgggaggcataatacagcat
cactgctctagtggagaagcaaaccatgcagttctcataactgggtttgataaaacagga
agtacgccatattggatagtccgaaactcctggggaaggtcatggggagtggatggctat
gcccatgtaaaaatgggagctaatatttgtggtattgcagattctgtttctgctgtattt
gtgtga

DBGET integrated database retrieval system