KEGG   Trichechus manatus latirostris (Florida manatee): 101346019Help
Entry
101346019         CDS       T05135                                 

Definition
(RefSeq) atrial natriuretic peptide receptor 1
  KO
K12323  atrial natriuretic peptide receptor A [EC:4.6.1.2]
Organism
tmu  Trichechus manatus latirostris (Florida manatee)
Pathway
tmu00230  Purine metabolism
tmu01100  Metabolic pathways
tmu04022  cGMP-PKG signaling pathway
tmu04024  cAMP signaling pathway
tmu04270  Vascular smooth muscle contraction
tmu04714  Thermogenesis
tmu04921  Oxytocin signaling pathway
tmu04923  Regulation of lipolysis in adipocytes
tmu04924  Renin secretion
tmu04925  Aldosterone synthesis and secretion
Brite
KEGG Orthology (KO) [BR:tmu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101346019
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    101346019
   04022 cGMP-PKG signaling pathway
    101346019
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    101346019
   04921 Oxytocin signaling pathway
    101346019
   04924 Renin secretion
    101346019
   04925 Aldosterone synthesis and secretion
    101346019
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101346019
  09159 Environmental adaptation
   04714 Thermogenesis
    101346019
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tmu01001]
    101346019
Enzymes [BR:tmu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101346019
Protein kinases [BR:tmu01001]
 Serine/threonine kinases: Other
  RGC family [OT]
   101346019
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc ANF_receptor Pkinase_Tyr Pkinase HNOBA Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 101346019
NCBI-ProteinID: XP_004388649
UniProt: A0A2Y9E7X9
Position
Unknown
AA seq 1056 aa AA seqDB search
MPGPGRPMGARLRLFLLPLLLLRGTHAGNLTVAVVLPLANTSYPWSWARVGPAVELALRR
VKARPDLLPGWTVRTVLGSSENALGACSDTAAPLAAVDLKWEHNPAVFLGPGCVYAAAPV
GRFTAHWRVPLLTAGAAALGFGAKDEYALTTRAGPSHAKLGDFVAALHRRLGWERQALVL
YAYRPGDDQPCFFVVEGLYMRVRDRLNITVDHLEFAEGDRDHYAALLRTVRRKGRVIYIC
SSPDAFRTLMLLALEAGLSGEDYVFFHLDLFGQSLQGAHSPAPRRPWERGDGQDVSAHQA
FQAAKIITYKEPDNPEYLEFLKQLKHLAREQFNFTMEDGLVNTIAASFHDGLLLYVQAVM
ETLAHGGIVTDGESITQRMWNRSFQGVTGYLKMDSNGDRETDFSLWDMDPETGVFRVVLN
YNGTSQELMAVSGRRLNWPLGYPPPDIPKCGFNNEDPACNQDHFSTLEVLALVGGLSLLS
ILIVSFFIYRKLQLEKELASELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLT
TEGQFQVFAKTAYYKGNLVAVKRVNRKRIELTRNVLFELKHMRDVQNEHLTRFVGACTDP
PNICILTEYCPRGSLQDILENESITLDWMFRYSLTNDIVKGMLFLHNGAICSHGNLKSSN
CVVDGRFVLKITDYGLESFRDPEPEQGHTLYAKKLWTAPELLRMASPPARGSQAGDVYSF
GIILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQGHLEELGQLMQRCWA
EDPQERPPFQQIRLTLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKA
EALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLY
TCFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVARMALALLDAVRSFRIRHRP
QEQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLE
EFGGFELELRGDVEMKGKGKVRTYWLLGERGGSTRG
NT seq 3171 nt NT seq  +upstreamnt  +downstreamnt
atgcccggccccgggcgccccatgggcgcccgtctgcgcctgttcctgctgccactgcta
ctgctccggggcacccacgcaggcaacctgacggtggccgtggtgctgccgctggccaac
acttcgtacccgtggtcgtgggcgcgcgtggggcccgccgtggagctcgccctaaggcgg
gtgaaggcgcggcccgacttgctgcccggctggacggtccgcacggtgctgggcagcagc
gagaacgcgctgggcgcctgctccgacaccgccgcgcccctggccgccgtggacctcaag
tgggagcacaaccccgcggtgttcctgggcccgggctgcgtgtacgcggccgcccctgtg
gggcgcttcacggcgcactggcgggtgccgctgctcaccgcgggcgccgcggcgctgggc
ttcggggccaaagacgagtacgcactgaccacccgcgcggggcccagccacgccaagctg
ggcgactttgtggcggcgctgcaccgacggctgggctgggaacgccaggcgctcgtgctc
tacgcctaccgacctggcgacgaccagccctgcttctttgtcgtggaggggctgtacatg
cgggtccgcgaccgcctcaacatcacggtggaccacctggagttcgccgagggcgaccgc
gaccactatgctgcgctgctgcggaccgtgcggcgcaagggcagagttatctacatctgc
agctccccagatgccttccgaaccctgatgctcctcgccctggaagccggcctcagtggg
gaggattatgttttcttccacctggacctctttgggcaaagcctgcaaggcgcacacagc
cctgctccccgaaggccctgggagagaggggatggtcaggatgtcagtgcccatcaggcc
tttcaggctgccaagatcattacgtacaaagagccagataatcctgagtatttggaattc
ctgaagcagctaaaacacttggcccgtgagcagttcaacttcaccatggaagatggcctg
gtgaacaccatcgcagcgtccttccatgatgggctcctgctctatgtccaggcagtgatg
gagactctggcgcacgggggcattgtcactgatggggagagcatcactcagaggatgtgg
aaccgaagcttccaaggtgtgacaggatacctgaaaatggacagcaacggagatcgggag
accgacttctccctctgggatatggatcctgagactggcgtcttcagggttgtgctgaac
tacaatgggacttcccaagagctgatggccgtatcggggcgcagactgaactggcccctg
gggtaccctcctcctgacatccccaaatgcggctttaacaacgaagaccctgcctgcaac
caagaccacttctccacgctggaggtactcgctttggtgggcggcctctccctgctcagc
attctgattgtctcttttttcatatacaggaagctgcagctggagaaggagctggcctcg
gagctatggcgggtgcgttgggaagacttgcagcccagcagccttgagcggcacctgcgg
agtgcaggcagccggctgaccctgagtgggagaggctccaattacggctccctgctaacc
acagagggccagttccaagtctttgccaagacagcgtattacaagggcaacctcgttgct
gtgaagcgcgtgaaccggaaacgcattgagctgacgagaaatgtcctgtttgaactgaag
catatgcgggatgtgcagaatgaacacctgaccaggtttgtgggtgcctgcaccgatccc
cccaacatctgcatcctcacagagtactgtccccgtgggagtctgcaggacattctggag
aacgagagcatcaccctggactggatgttccgctactctctcaccaatgacatcgtcaag
ggtatgctgttcctacacaatggggccatttgttcccatgggaacctcaagtcatccaac
tgcgtcgtagatgggcgctttgtgctcaagatcaccgactatgggctggagagcttcagg
gacccggagccagagcaaggacacaccctctatgccaaaaagttgtggacggctcctgag
ctccttcgaatggcttcgccccctgcccggggctcccaggctggtgatgtgtacagcttt
gggatcatccttcaggagattgccctgaggagtggggtcttccacgtggagggcttggac
ctcagccccaaagagatcatcgagcgtgtgactcggggtgagcagccccccttccggccc
tccctggccctgcagggtcacctggaggagctggggcagctgatgcagcggtgctgggcc
gaggacccacaggagcggccgcccttccagcagatccgcctgacactgcgcaagtttaac
agagagaacagcagcaacatcctggacaacctactgtcccgcatggagcagtatgccaac
aacctagaggagctggtggaggagcgcacgcaggcctacctggaggagaagcgcaaggct
gaggccctgctctaccagattctgcctcactcagtggctgagcagctgaagcgtggggaa
acggtccaggccgaggcctttgacagcgtcaccatctacttcagtgacattgtgggcttt
acagctctgtcagcagagagcacgcccatgcaggtggtcaccctgctgaatgacctgtac
acttgctttgatgccgtcattgacaactttgatgtgtacaaggtggagacgatcggcgac
gcctacatggtggtgtctgggctcccggtgcggaacgggcggctgcacgcccgcgaggtg
gcccgcatggccctggcgctgctggacgccgtccgctcgttccgcatccgccaccggccc
caggagcaactgcgcttgcgcatcggcatccacacaggccccgtgtgtgctggcgtggtg
ggactgaagatgccccgttactgtctgttcggggacacagtcaacacggcctcacgaatg
gaatctaacggggaagctctgaagatccacttgtcttctgagaccaaggctgtcctggag
gagttcggtggttttgagctggagcttcgaggggatgtagaaatgaagggcaaaggcaag
gttcggacatactggctcctgggagagcggggcggtagcacccggggctga

DBGET integrated database retrieval system